The northernmost province of South Africa
POPULARITY
Categories
My guest on this episode is just down the Texan road from me, Hal Rose. Hal first hunted South Africa back in 1994 and only returned some twenty years later. Well, as Hal will re-tell, the African bug bit him harder on his second trip and since then he has planned on returning to hunt this beautiful land every year since. Hal shares some great stories across his 3 trips to South Africa, from Kwa-Zulu Natal, to Limpopo and down to the Eastern Cape. He also shares some great advice for those new hunters, looking at hunting Africa. If you would like to reach out to Hal and talk about hunting or maybe even get some feedback on an outfitter you are looking at, then you can reach him via email on: halrose01@gmail.com Hey, do me a favor? If you are enjoying these episodes, then please leave a 5* rating and review on Apple Podcasts and Spotify. It don't cost anything and only takes 2 seconds. Thanks!
John Maytham speaks to Reynold Thakuli about the floods in Limpopo, affecting the Kruger National Park. Presenter John Maytham is an actor and author-turned-talk radio veteran and seasoned journalist. His show serves a round-up of local and international news coupled with the latest in business, sport, traffic and weather. The host’s eclectic interests mean the program often surprises the audience with intriguing book reviews and inspiring interviews profiling artists. A daily highlight is Rapid Fire, just after 5:30pm. CapeTalk fans call in, to stump the presenter with their general knowledge questions. Another firm favourite is the humorous Thursday crossing with award-winning journalist Rebecca Davis, called “Plan B”. Thank you for listening to a podcast from Afternoon Drive with John Maytham Listen live on Primedia+ weekdays from 15:00 and 18:00 (SA Time) to Afternoon Drive with John Maytham broadcast on CapeTalk https://buff.ly/NnFM3Nk For more from the show go to https://buff.ly/BSFy4Cn or find all the catch-up podcasts here https://buff.ly/n8nWt4x Subscribe to the CapeTalk Daily and Weekly Newsletters https://buff.ly/sbvVZD5 Follow us on social media: CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.
The N1 road outside Louis Trichardt in Limpopo, has been closed following a crash which involved four vehicles. A truck, a bus, a sedan and bakkie collided with each other. According to eye witnesses, the bus driver allegedly ignored a stop-and-go sign and lost control and crashed into other vehicles. Sakina Kamwendo caught with our reporter Rudzani Tshivhase...
In this episode of Farmer's Inside Track, Limpopo poultry farmer and agripreneur Kamogelo Thobejane shares practical, experience-driven tips to help South African producers maximise every kilogram of poultry feed. From understanding protein, vitamins, minerals and age-specific formulations to spotting poor-quality feed, preventing spillage, adjusting feeders, and avoiding costly mistakes like constant brand switching, Kamogelo breaks down the essentials of efficient, profitable broiler and layer production. Whether you're a new or seasoned poultry farmer, this episode offers clear, actionable guidance to improve bird performance.
Die Hooggeregshof in Polokwane het 'n sakeman van Limpopo, Rameez Patel, tot lewenslange tronkstraf gevonnis vir die moord op sy vrou, Fatima, in 2015. Hy het ook vyf jaar ontvang vir die onwettige besit van 'n vuurwapen en drie jaar vir ammunisie. Regter Joseph Raulinga het bevind Patel het geen berou getoon nie en bewerings dat daar indringers was verwerp. Die streekswoordvoerder van die Nasionale Vervolgingsgesag, Mashudu Malabi, het die vonnis verwelkom as 'n sterk standpunt teen geslagsgeweld:
Gugs Mhlungu speaks with Keletso Monareng, PhD candidate in Physics at the University of Limpopo and winner of the 2025 L’Oréal-UNESCO For Women in Science Award, about her groundbreaking research on sodium-ion batteries, the motivation behind developing sustainable battery technology, how sodium batteries work, and the potential impact of her work on the future of clean energy. 702 Weekend Breakfast with Gugs Mhlungu is broadcast on 702, a Johannesburg based talk radio station, on Saturdays and Sundays Gugs Mhlungu gets you ready for the weekend each Saturday and Sunday morning on 702. She is your weekend wake-up companion, with all you need to know for your weekend. The topics Gugs covers range from lifestyle, family, health, and fitness to books, motoring, cooking, culture, and what is happening on the weekend in 702land. Thank you for listening to a podcast from 702 Weekend Breakfast with Gugs Mhlungu. Listen live on Primedia+ on Saturdays and Sundays from 06:00 and 10:00 (SA Time) to Weekend Breakfast with Gugs Mhlungu broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/u3Sf7Zy or find all the catch-up podcasts here https://buff.ly/BIXS7AL Subscribe to the 702 daily and weekly newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702See omnystudio.com/listener for privacy information.
Gegründet hat sich der Ndlovu Youth Choir im Jahr 2009 in Limpopo im Norden von Südafrika. In diesem Jahr ist er so richtig bekannt geworden, als er die "Bohemian Rhapsody" von Queen in ihrer Sprache Zulu herausbrachte.
In this episode, chartered accountant Desry Lesele, driven by his Limpopo farm roots and role as Nedbank's senior agriculture manager, shows farmers how to conquer rising costs, weather volatility, and tight margins with tailored financial tools for growth and resilience.From witnessing his grandmother's struggles growing sorghum and maize, Lesele crafts solutions against input price surges, grain oversupply, and climate threats risking 40% yield losses, urging early banker ties, tech investments, and diversification.He insists that farmers should treat farming as a business by tracking records, planning strategically, and using finance as a survival edge for food security and rural jobs.
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
Transport Minister Barbara Creecy is leading an inter-provincial law enforcement operation aimed at road users travelling between Gauteng, Limpopo, and North West during this festive season. Last month the Minister officially launched the 365-day Arrive Alive Road Safety Campaign. She has called on all South Africans to take personal responsibility for reducing crashes and fatalities on the country's roads as the 2025/26 festive season begins. Bongiwe Zwane spoke to Deputy Transport Minister Mkhuleko Hlengwa
Die 2025 Suid-Afrikaanse Versoeningsbarometer toon slegs 31-persent van burgers het baie vertroue in die Regering van Nasionale Eenheid met 34-persent wat min vertroue toon. 'n Navorser, Kate Lefko-Everett, sê vertroue is in die Wes-Kaap, Noordwes en Limpopo die hoogste en die laagste in die Noord-Kaap, KwaZulu-Natal en die Vrystaat. Sy verbind dié gemengde resultate aan bestuur, dienslewering en aanspreeklikheid want armoede en ongelykheid is steeds groot struikelblokke:
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
In part 3 of our special Farmer's Inside Track series with Nedbank, we explore how Subtrop is transforming the lives and businesses of emerging farmers in Limpopo. Subtrop's transformation manager, Stephen Mantsho, breaks down the organisation's practical approach — from technical training and Global GAP accreditation to improved market access and the rise of black-owned packhouses and processing facilities. With Nedbank's support, farmers in regions like Vhembe and Mopani are scaling from small plots to profitable commercial operations, proving that meaningful, sustainable agricultural transformation is not only possible but already underway.
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
SoilSistas, a partnership between Corteva Agriscience and GIBS, proudly celebrates 50 empowered women farmers graduating this year. The 12-month programme equips rural women with sustainable farming, financial literacy, and business skills to overcome barriers and boost food security. Graduates like Dora Masehela from Limpopo testify to the powerful mix of classroom learning and hands-on training, enabling them to build profitable, community-focused farms. SoilSistas is transforming lives and landscapes, nurturing women as both farmers and leaders ready to grow South Africa's agricultural future.
Road Trip's Podcast - Travel, Touring and Holidays in South Africa
Send us a textAn emotive issue - Hunting and Trophy Hunting. As you drive through South Africa - particularly in Northern KZN, Mpumalanga, North West, Limpopo, and now the Eastern Cape as well - you pass kilometres of high electrified fencing.These are what we call "Game Farms" - aimed at tourism and hunting. We explore the topic and the importance of this industry to South Africa.Some resources:https://africageographic.com/stories/botswana-elephant-hunting-under-scientific-review/?utm_source=Africa+Geographic&utm_campaign=426952b838-AGNewsletter_November_04_2025_resend&utm_medium=email&utm_term=0_32007fbc2b-426952b838-292991874&mc_cid=426952b838&mc_eid=d520cdf556https://news.nwu.ac.za/r15456-billion-private-wildlife-hunting-means-big-buckshttps://businesstech.co.za/news/business/206214/how-much-you-pay-to-go-trophy-hunting-in-south-africa/The Road Trip SA app is available for downloadDo you want to visit and explore South Africa? Touch Africa Safaris
Send us a textAn emotive issue - Hunting and Trophy Hunting. As you drive through South Africa - particularly in Northern KZN, Mpumalanga, North West, Limpopo, and now the Eastern Cape as well - you pass kilometres of high electrified fencing.These are what we call "Game Farms" - aimed at tourism and hunting. We explore the topic and the importance of this industry to South Africa.Some resources:https://africageographic.com/stories/botswana-elephant-hunting-under-scientific-review/?utm_source=Africa+Geographic&utm_campaign=426952b838-AGNewsletter_November_04_2025_resend&utm_medium=email&utm_term=0_32007fbc2b-426952b838-292991874&mc_cid=426952b838&mc_eid=d520cdf556https://news.nwu.ac.za/r15456-billion-private-wildlife-hunting-means-big-buckshttps://businesstech.co.za/news/business/206214/how-much-you-pay-to-go-trophy-hunting-in-south-africa/The Road Trip SA app is available for downloadDo you want to visit and explore South Africa? Touch Africa Safaris
Elvis Presslin takes a look at the current top African economic stories. with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
Die Madlanga-kommissie se aandag wend terug na die 121 misdaaddossiere wat van Durban na Gauteng verskuif is. Die EFF eis die vrystelling van die Konstitusionele Hof se uitspraak oor die diefstalskandaal by president Cyril Ramaphosa se plaas in Limpopo. Die jongste misdaadstatistiek word ná twee keer se uitstel, bekendgemaak.
RISE Mzansi het sy kommer uitgespreek dat ongeveer 118 uit 1 165 polisiestasies as onbewoonbaar geklassifiseer word. Waarnemende polisieminister, Firoz Cachalia het vroeër gesê die stasies wat die meeste geraak word, is in Noordwes, Limpopo en KwaZulu-Natal - almal in gebiede wat hoë misdaad beveg. Hy het 35 beplande opgraderings aangekondig, insluitend nuwe bouwerk en herstelwerk, gerugsteun deur 'n begroting van 305 miljoen Suid-Afrikaanse rand. Makashule Gana van RISE Mzansi doen 'n beroep op toesigbesoeke om behoorlike besteding en veiliger werksomstandighede te verseker:
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
In this inspiring episode, we sit down with Andries Masoga of Mazeli Farming and Projects, a family-run agribusiness in Limpopo that grew from a small backyard garden into a thriving 140-hectare enterprise. Andries shares how his wife, Tsakani Masoga's passion for home gardening sparked a journey that now spans tomatoes, potatoes, butternut, and peppadew under formal offtake agreements with major companies, such as PepsiCo and Peppadew International. From their first 10 hectares granted by the local traditional council to employing over 160 local workers, the Masoga family's story is one of impact. Tune in to hear how they have built a legacy grounded in family succession and rural transformation.
Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo
Today's Show with Makone Maja and Nicholas Lorimer discusses the latest budget news. They also discuss the NPA and water problems in Limpopo. Website · Facebook · Instagram · Twitter
Die Departement van Landbou het 'n waarskuwing uitgereik oor hoërisikogebiede vir hondsdolheid in Suid-Afrika, waar die siekte onder honde, Kaapse pelsrobbe en ander soogdiere voorkom. Hondsdolheid is 'n dodelike virussiekte wat alle soogdiere aantas en in die speeksel van besmette diere na mense kan versprei. Die departement se woordvoerder, Prince Mtsweni, sê daar was vanjaar menslike sterftes in KwaZulu-Natal, die Oos-Kaap en Limpopo wat toegeskryf kan word aan hondsdolheid:
Relebogile Mabotja speaks to the Award-winning actor and musician, Clement Maosa best known for his role as Zamokuhle "Kwaito" on Skeem Saam about his acting career, growing up in Limpopo and the lessons he has learned from failure. 702 Afternoons with Relebogile Mabotja is broadcast live on Johannesburg based talk radio station 702 every weekday afternoon. Relebogile brings a lighter touch to some of the issues of the day as well as a mix of lifestyle topics and a peak into the worlds of entertainment and leisure. Thank you for listening to a 702 Afternoons with Relebogile Mabotja podcast. Listen live on Primedia+ weekdays from 13:00 to 15:00 (SA Time) to Afternoons with Relebogile Mabotja broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/2qKsEfu or find all the catch-up podcasts here https://buff.ly/DTykncj Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 See omnystudio.com/listener for privacy information.
Limpopo Bus Tragedy Exposes South Africa's Failing Road Safety Practices | Johan Jonck by Radio Islam
Clement Manyathela speaks with the listeners on the 42 fatalities in a horrific bus crash on the N1 highway in Limpopo. They touch on the precautions that should be taken by bus companies, they also reflect on what the expectations are with the testimony of Shadrack Sibiya at the ad-hoc commission in parliament. The Clement Manyathela Show is broadcast on 702, a Johannesburg based talk radio station, weekdays from 09:00 to 12:00 (SA Time). Clement Manyathela starts his show each weekday on 702 at 9 am taking your calls and voice notes on his Open Line. In the second hour of his show, he unpacks, explains, and makes sense of the news of the day. Clement has several features in his third hour from 11 am that provide you with information to help and guide you through your daily life. As your morning friend, he tackles the serious as well as the light-hearted, on your behalf. Thank you for listening to a podcast from The Clement Manyathela Show. Listen live on Primedia+ weekdays from 09:00 and 12:00 (SA Time) to The Clement Manyathela Show broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/XijPLtJ or find all the catch-up podcasts here https://buff.ly/p0gWuPE Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 See omnystudio.com/listener for privacy information.
My guest on the latest episode is Devin from Kansas City and we had a great chat, covering all sorts of topics from how he chose his outfitter, bringing over your own rifle, the importance of not sticking to a list, trusting yourself to pull of a quick 'hail Mary' shot, plus Devin gave some fantastic advice for those planning their first trip to Africa. If you are enjoying these episodes and getting some value out of them, then do me a massive favour and take a few seconds to leave a review and rating on Apple podcasts and Spotify. Thanks! Get in touch with Devin or follow along on his hunting journeys on his instagram: @celebratory_gunfire
After over a year of by-elections since the national election, Elections Analyst Wayne Sussman gives Chris Steyn an update of the latest shifts in the political landscape. “One of the trends we continue to see is that the ANC candidates for council in provinces like the Eastern Cape and Limpopo will know that they are very likely to hold on to their seats come the election next year. The party which should be happiest right now is probably the Patriotic Alliance because they've shown a continued growth of trajectory. But you're also seeing a party like the DA starting to put in good performances.” Previewing the next round of by-elections, Sussman warns that the ANC - that had a “very sharp fall” in a recent Soweto by-election - will face the “Chasing Pack” in the upcoming one; “the bragging rights for second place or even third place, because between MK, EFF, Patriotic Alliance, ActionSA and the DA…only five percentage points separated party two to six. So it's a real scrum in that Chasing Pack. And I think the pecking order is going to be very important.” Sussman also describes how the DA managed to edge out the ANC in Ga-Nala Mpumalanga. “The key municipality of eMahlahleni is now hung because the ANC has lost its outright majority.” He also dissects all the other recent results along with the prospects of the parties in the next round.
Aubrey Masango speaks to Refiloe Nkadimeng, CFO of African Rainbow Capital exploring her work and growth in the financial space. They touch on her upbringing, how it has shaped the person she has become.Tags: 702, The Aubrey Masango Show, Aubrey Masango, Profile Interview, Refiloe Nkadimeng, Finances, African Rainbow Capital. Limpopo, Inspiration The Aubrey Masango Show is presented by late night radio broadcaster Aubrey Masango. Aubrey hosts in-depth interviews on controversial political issues and chats to experts offering life advice and guidance in areas of psychology, personal finance and more. All Aubrey’s interviews are podcasted for you to catch-up and listen. Thank you for listening to this podcast from The Aubrey Masango Show. Listen live on weekdays between 20:00 and 24:00 (SA Time) to The Aubrey Masango Show broadcast on 702 https://buff.ly/gk3y0Kj and on CapeTalk between 20:00 and 21:00 (SA Time) https://buff.ly/NnFM3Nk Find out more about the show here https://buff.ly/lzyKCv0 and get all the catch-up podcasts https://buff.ly/rT6znsn Subscribe to the 702 and CapeTalk Daily and Weekly Newsletters https://buff.ly/v5mfet Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.
The Live for Yourself Revolution Podcast: Living toward greater health, wealth, and happiness
After selling her first travel company Under Canvas in 2018, for more than $100 million, Sarah Dusek launched Enygma Ventures a US based venture capital fund to invest in Africa's talented female entrepreneurs and contribute towards rectifying the great funding imbalance.Over the last 5 years Sarah's work has impacted over 10,000 entrepreneurs who have gone through Enygma's investor-ready programs to learn how to build valuable, companies, demystify the complicated and often inaccessible world of funding. In her new book “Thinking Bigger: A Pitch Deck Formula For Women Who Want To Change the World”, Sarah shares the challenges of her own journey building a $100 million company and shares the critical building blocks needed to scale any business.Today Sarah is the CoFounder & CEO of Few & Far, a net positive travel/climate company investing in large scale regeneration of landscapes, carbon sequestration and creating extraordinary travel experiences.She recently opened her newest lodge Few & Far Luvhondo, set the Soutpansberg mountains of Limpopo, South Africa – an area larger than Singapore which represents 100,000 hectares of incredible biodiversity but remains under serious threat from mining claims and deforestation.Sarah aims to reimagine the safari experience by pioneering the world's first aerial safari and creating very unique experiences in this remote part of South Africa. Sarah believes business can be, and should, be a force for good driving our world forward.Links to include: www.fewandfarluvhondo.com
Clement Manyathela speaks to Andries Lekalakala, the Head of Communication for the Limpopo Legislature to discuss the controversy surrounding the insistence of a Limpopo Legislature executive in adding a PhD title on his flight ticket to the Gambia.The Clement Manyathela Show is broadcast on 702, a Johannesburg based talk radio station, weekdays from 09:00 to 12:00 (SA Time). Clement Manyathela starts his show each weekday on 702 at 9 am taking your calls and voice notes on his Open Line. In the second hour of his show, he unpacks, explains, and makes sense of the news of the day. Clement has several features in his third hour from 11 am that provide you with information to help and guide you through your daily life. As your morning friend, he tackles the serious as well as the light-hearted, on your behalf. Thank you for listening to a podcast from The Clement Manyathela Show. Listen live on Primedia+ weekdays from 09:00 and 12:00 (SA Time) to The Clement Manyathela Show broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/XijPLtJ or find all the catch-up podcasts here https://buff.ly/p0gWuPE Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702See omnystudio.com/listener for privacy information.
In his latest interview with Chris Steyn, elections analyst Wayne Sussman gives the backstory to gunmen taking control of a municipal council in Northwest where different factions of the African National Congress (ANC) are backing different mayors. “…this crazy scenario of the rival factions having gunmen in the municipality, gunmen near a council chamber, near the engine of this municipality, is greatly concerning, not just for our democracy, but also for service delivery in South Africa,” Sussman says. Furthermore, at least 148 municipal officials have been murdered since 2018 - and two by-elections in the space of seven days are because of assassinations. “… people resort to literally killing their opponents,” he says. Sussman gives an in-depth analyses of the by-election results of the last two rounds with trends showing that the Patriotic Alliance continues to “do a lot of damage” to the ANC, but that its support remains “absolutely rock solid" in Limpopo and in the Eastern Cape. Meanwhile, the Democratic Alliance had a “morale boosting" victory in the Northern Cape.
Die DA in Limpopo sê onwettige sandmynbou langs die Sandrivier benadeel die omgewing, die watergehalte en boere se lewensbestaan. Boere en landelike gemeenskappe ondervind ernstige probleme met besproeiing en toegang tot water. Die party sê dit lyk asof baie bedrywighede die behoorlike openbare deelnameprosesse omseil het. Die DA-lid, Jacques Smalle, belowe om dringende optrede aan te moedig om die rivier en omliggende ekostelsels te beskerm:
Bongani Bingwa speaks with Chief Livhuwani Matsila, traditional leader of the Matsila people, about the Vhembe District Municipality being the home to the highest number of centenarians in South Africa. Nearly half of them live in the Thulamela Local Municipality, where the longevity rates rival those of Japan’s renowned “Blue Zone” in Okinawa. 702 Breakfast with Bongani Bingwa is broadcast on 702, a Johannesburg based talk radio station. Bongani makes sense of the news, interviews the key newsmakers of the day, and holds those in power to account on your behalf. The team bring you all you need to know to start your day Thank you for listening to a podcast from 702 Breakfast with Bongani Bingwa Listen live on Primedia+ weekdays from 06:00 and 09:00 (SA Time) to Breakfast with Bongani Bingwa broadcast on 702: https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/36edSLV or find all the catch-up podcasts here https://buff.ly/zEcM35T Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 See omnystudio.com/listener for privacy information.
Nicholas Lorimer and Terence Corrigan discuss the growing evidence that the ANC is in big trouble in the next municipal election. They also discuss a shocking lack of resources in the South African Police Service and a legacy of broken promises in the Limpopo village. Website · Facebook · Instagram · Twitter
Pippa speaks to Retang Phaahla, the founder and CEO of a business called Setsong Tea Crafters. She’s a tea crafter who is drawing on indigenous botanical knowledge to create jobs and drive tourism in rural Limpopo. Lunch with Pippa Hudson is CapeTalk’s mid-afternoon show. This 2-hour respite from hard news encourages the audience to take the time to explore, taste, read and reflect. The show - presented by former journalist, baker and water sports enthusiast Pippa Hudson - is unashamedly lifestyle driven. Popular features include a daily profile interview #OnTheCouch at 1:10pm. Consumer issues are in the spotlight every Wednesday while the team also unpacks all things related to health, wealth & the environment. Thank you for listening to a podcast from Lunch with Pippa Hudson Listen live on Primedia+ weekdays between 13:00 and 15:00 (SA Time) to Lunch with Pippa Hudson broadcast on CapeTalk https://buff.ly/NnFM3Nk For more from the show go to https://buff.ly/MdSlWEs or find all the catch-up podcasts here https://buff.ly/fDJWe69 Subscribe to the CapeTalk Daily and Weekly Newsletters https://buff.ly/sbvVZD5 Follow us on social media: CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.
Kgomotso Modise standing in for Aubrey Masango chats to Lebohang Moloto, the founder of The Real Makoya Detergent as they discuss what it takes in starting a business, what goes into making one’s business a success and we will also get to hear her future aspirationsTags: 702, Aubrey Masango show, Aubrey Masango, Kgomotso Modise, The Real Makoya cleaning detergent, Lebohang Moloto, Limpopo, Spar, Makro, OK supermarket, Cleaning detergent The Aubrey Masango Show is presented by late night radio broadcaster Aubrey Masango. Aubrey hosts in-depth interviews on controversial political issues and chats to experts offering life advice and guidance in areas of psychology, personal finance and more. All Aubrey’s interviews are podcasted for you to catch-up and listen. Thank you for listening to this podcast from The Aubrey Masango Show. Listen live on weekdays between 20:00 and 24:00 (SA Time) to The Aubrey Masango Show broadcast on 702 https://buff.ly/gk3y0Kj and on CapeTalk between 20:00 and 21:00 (SA Time) https://buff.ly/NnFM3Nk Find out more about the show here https://buff.ly/lzyKCv0 and get all the catch-up podcasts https://buff.ly/rT6znsn Subscribe to the 702 and CapeTalk Daily and Weekly Newsletters https://buff.ly/v5mfet Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.
Suid-Afrika herdenk vandag Vrouedag en die regering sê hierdie jaar kyk na die vordering wat vroue gemaak het in leierskap en die ekonomiese lewe, en die stryd teen geslagsgeweld. Die 2025 Nasionale Vrouedag-vieringe met die tema “Die bou van veerkragtige ekonomieë vir almal" sal by die Nkowankowa Stadion in Tzaneen, Limpopo, gehou word. Die minister in die Presidensie, Khumbudzo Ntshavheni sê Vrouemaand is 'n oproep tot aksie vir volledige en gelyke deelname in die vorming van Suid-Afrika se toekoms:
'n 37-jarige aanlyn-afspraakreeksverkragter en -moordenaar, wat aan meer as tien sake in Eersterust, Pretoria, verbind word, is in Limpopo in hegtenis geneem. Die verdagte het 'n gewilde afspraak-webwerf gebruik om sy vroulike slagoffers na sy woning in Eersterust te lok. 'n Polisiewoordvoerder, Malesela Ledwaba, sê hy het na bewering sommige van sy slagoffers verkrag, tot die mees onlangse voorval toe hy die slagoffer na bewering verkrag en vermoor het, en haar daarna in 'n vlak graf by sy woning begrawe het:
On episode 523 of The Nurse Keith Show nursing and healthcare career podcast, Keith interviews author, nursing educator, and researcher Dr. Ruth Wittmann-Price, PhD, RN, CNS, CNE, CNEcl, CHSE, ANEF, FAAN. In the course of their conversation, Keith and Dr. Wittmann-Price discuss the importance and impact of competency-based education in nursing. Dr. Wittmann-Price also reflects on her storied career, and her perceptions and experiences as a highly accomplished nurse academician and writer. Ruth A. Wittmann-Price, PhD, RN, CNS, CNE, CNEcl, CHSE, ANEF, FAAN, is Dean of the W. Cary Edwards School of Nursing and Health Professionals at Thomas Edison State University in Trenton, NJ. Ruth has been an obstetrical/women's health nurse for 47 years. Dr. Wittmann-Price received her AAS and BSN degrees from Felician College, Lodi, New Jersey, and her MS as a perinatal clinical nurse specialist (CNS) from Columbia University, New York, New York. She completed her PhD in nursing at Widener University, Chester, Pennsylvania, and received the Dean's Award for Excellence. Ruth developed a mid-range nursing theory, “Emancipated Decision-Making in Women's Health Care,” and has tested her theory in four research studies. International researchers are currently using her theory as the foundation for their studies. Her theory is being used by researchers at the University of Limpopo, South Africa, in their campaign, “Finding Solutions for Africa,” which helps women and children. Dr. Wittmann-Price has taught all levels of nursing students over the past 30 years and has completed international service-learning trips. She has coedited or authored 16 books, contributed many chapters, and written numerous articles. She has presented her research regionally, nationally, and internationally. Dr. Wittmann-Price was inducted into the National League for Nursing Academy of Nurse Educator Fellows in 2013 and became a fellow in the American Academy of Nursing in October 2015. This episode of the Nurse Keith Show is brought to you in collaboration with Springer Publishing, who have been delivering award-winning healthcare education and exam prep materials focused on nursing, behavioral health, and the health sciences for more than 70 years. We thank Springer Publishing for their support. Links: Fast Facts About Competency-Based Education in Nursing: How to Teach Competency Mastery Certified Nurse Educator Review, 4th Edition Springer Publishing Contact Nurse Keith about holistic career coaching to elevate your nursing and healthcare career at NurseKeith.com. Keith also offers services as a motivational and keynote speaker and freelance nurse writer. You can always find Keith on LinkedIn. Are you looking for a novel way to empower your career and move forward in life? Keith's wife, Shada McKenzie, is a gifted astrologer and reader of the tarot who combines ancient and modern techniques to provide valuable insights into your motivations, aspirations, and life trajectory, and she offers listeners of The Nurse Keith Show a 10% discount on their first consultation. Contact Shada at TheCircelandtheDot.com or shada@thecircleandthedot.com.
ActionSA sê Suid-Afrika se bemagtigingsagenda moet aanhou fokus op die behoeftes van Suid-Afrikaners en nie buitelandse burgers bevoordeel nie. Die party sê die Polokwane plaaslike munisipaliteit in Limpopo het die afgelope twee boekjare tenders ter waarde van ongeveer 200-miljoen Suid-Afrikaanse rand aan buitelandse ondernemings toegeken. Tshepo Magoma van ActionSA sê die doel van swart ekonomiese bemagtiging is om geskiedkundige ongeregtighede reg te stel en voorheen-benadeelde Suid-Afrikaanse burgers te bemagtig:
John Luyt is one of the professional hunters that works in the APNR - the Associated Private Nature Reserves of the Kruger National Park. These reserves were setup to incorporate into Kruger National Park and allow for more movement of wildlife. With the dropping of fences, Kruger's burgeoning elephant population has spilled into the APNR, where legal, highly regulated hunting of elephants occurs. The hunting of elephants in this area has gone through significant upheaval since 2021, when Humane Society International put a court interdict in place stopping export of elephant trophies. Today, we get a huge step forward towards returning to pre-2021. John brings Robbie breaking news out of the Limpopo Province of South Africa that now, for the first time in quite some time, international hunters may now hunt nonexportable elephants in the Limpopo Province, along with a history of why this is such a significant clawback of ground after several battles in and out of court. Get to know the guest: https://www.instagram.com/johnluyt/?hl=en Do you have questions we can answer? Send it via DM on IG or through email at info@bloodorigins.com Support our Conservation Club Members! Bar JP Safaris: https://www.barjpsafaris.com/ Cabassa Safaris: https://cabassasafaris.com/ Robin Hurt Safaris Namibia: https://www.robinhurt.com/hunting-safaris-namibia.html See more from Blood Origins: https://bit.ly/BloodOrigins_Subscribe Music: Migration by Ian Post (Winter Solstice), licensed through artlist.io This podcast is brought to you by Bushnell, who believes in providing the highest quality, most reliable & affordable outdoor products on the market. Your performance is their passion. https://www.bushnell.com This podcast is also brought to you by Silencer Central, who believes in making buying a silencer simple and they handle the paperwork for you. Shop the largest silencer dealer in the world. Get started today! https://www.silencercentral.com This podcast is brought to you by Safari Specialty Importers. Why do serious hunters use Safari Specialty Importers? Because getting your trophies home to you is all they do. Find our more at: https://safarispecialtyimporters.com Learn more about your ad choices. Visit megaphone.fm/adchoices
Die regering beplan om in plattelandse slagpale en dieregesondheidsnavorsing te belê om siektebeheer te bevorder en die vee-ekonomie te versterk. Die minister van Landbou, John Steenhuisen, het die aankondiging gedoen op die bek-en-klouseer-indaba in Roodeplaat, Pretoria, waar hy die verouderde reaksiestelsels en vertragings in entstofvervaardiging gekritiseer het. Hy sê die nuwe beleggings in plattelandse slagpale en voerkrale, veral in Limpopo, Mpumalanga, en KwaZulu-Natal, sal help om die onwettige beweging van vee te verminder en wetstoepassing te bevorder:
Doug R telling his story at the Limpopo AA Rally South Africa Nov. 2012. Support Sober Cast: https://sobercast.com/donate Email: sobercast@gmail.com Sober Cast has 2900+ episodes available, visit SoberCast.com to access all the episodes where you can easily find topics or specific speakers using tags or search. https://sobercast.com
All manner of things are going on — thanks to those folks out there who've been sending me notes and support, much appreciated. Episode 220 deals with the start of the Transvaal Civil War, and quite a bit about Paul Kruger's early life. The American civil war was raging in 1862, and there's nothing like a war to trigger innovation — if you excuse the pun. Richard Jordan Gatling patented his terrifying Gatling gun featuring multiple rotating barrels driven by a hand crank, allowing operators to unleash a relentless hailstorm of bullets—up to several hundred rounds per minute. Its distinctive mechanical whirr echoed across battlefields, marking a chilling shift toward modern, industrialized warfare. While undoubtedly efficient, the Gatling gun also embodied a grim reality: the age when technology would reshape combat forever had arrived. Just in time to cause more chaos in the already bloody American Civil War. What is less known these days is that there was another Civil War involving descendants of Europeans, and this was going on in South Africa. The AmaZulu had just wrapped up their own recent Civil War as you've heard. All manner of brutal and uncivil conduct marked this period in South African history, as neighbour turned against neighbour and the bonds of society frayed. The Boer Republics had been riven by conflict since the days of the Voortrekkers, but in 1862 perhaps inspired in part by the American civil War, the Boer Republics went from squabbling to skirmishing. There's no proof that the carnage of the United States directly influenced South Africa, but there is proof that the Boers knew about it. Later, during the apartheid period of National Party Rule, this Transvaal Civil War was deposited in historical file 13, almost expunged, because it contradicted the prevailing political ideology where it was all the whites against all the blacks. Anything that detracted from this nationalist agenda was taboo. The modern architects of African nationalism, too, often reshape the past to suit their narratives, discarding inconvenient histories into their own version of "file 13."Compared to the carnage in America, where an estimated 750 000 people died, the South African version was far less bloody. A few dozen dead and wounded. A handful of skirmishes was the real effect, which took place in what is now Gauteng, Limpopo, Mpumalanga and the North West Province - but at the same time as the American Civil War which ran from 1861 to 1865. The Transvaal Civil War started in 1862 and ended in 1864. While less gory, it was emblematic of the frontier streak embedded in the first generation descendants of the Voortrekkers. According to the constitution of the Republic, the Hervormde Church was the state church. Its members alone were entitled to exercise any influence in public affairs. Whoever was not a member of the Hervormde Church was not a fully-qualified burgher. Paul Kruger belonged to the Christelljk-Gereformeerde Kerk founded recently, in 1859, by Dr. Postma, at Rustenburg. This church became known in South Africa as the Dopper, or partly Canting Church. The derivation of the word Dopper is not completely clear, but it was believed to have come from the word dop, a damper or extinguisher for putting out Candles.
Described as ‘the first lady of Irish cycling', Dervla Murphy was renowned for her intrepid spirit, and she remained passionate about travel, writing, politics, conservation and bicycling until her death in 2022. In this episode of the Slightly Foxed podcast we have gathered a number of those who knew and worked with Dervla to discuss the life and work of this extraordinary travel writer. Gail Pirkis and Steph Allen, from Slightly Foxed, worked with Dervla during their time at John Murray Publishers. Rose Baring was her editor at Eland Books and Ethel Crowley was a friend and editor of the recent anthology, Life at Full Tilt: The Selected Writings of Dervla Murphy. Together with our host Rosie Goldsmith they discuss Dervla's early years and inspiration, consider the experience of publishing her work and examine her place in the Ireland of her time. Born in Lismore, Ireland, in 1931, Dervla lived there until the end of her life. She was an only child and her parents, who originated from Dublin, encouraged her independence and love of books. Her father – who later became the much-loved Waterford County Librarian ‒ had been involved in the Irish republican movement and had served time in Wormwood Scrubs prison for his activities. Dervla spent her childhood caring for her mother who suffered from rheumatoid arthritis, and then left school at 14 to care for her full-time. When her parents died in 1962 Dervla, at the age of 30, found herself free to travel. She acquired a bicycle and set out on a journey to Istanbul, through Iran and on to India during one of the worst winters in recent memory. This would become the subject of her first, and most famous book, Full Tilt: Ireland to India with a Bicycle, published in 1965. There followed numerous voyages with her trusty steed and 25 more books, including her highly acclaimed autobiography Wheels within Wheels. She won worldwide praise for her writing and many awards, including the Edward Stanford Award for an Outstanding Contribution to Travel Writing and a Royal Geographical Society Award. Dervla took huge risks, mostly travelling alone and in famously austere style, whether in far-flung Limpopo, the Andes, Gaza or closer to home, where she documented the worst of the Troubles in Northern Ireland. Battling injury and political circumstance, she immersed herself in the lives of ordinary people caught in the shifting tides of power that dictated the terms on which they lived. To these people, she listened. What resulted was some of the most astute and compelling travel writing of the twentieth century. As the table choose their favourite book of Dervla's, we also have our usual round-up of current reading, including the latest mystery from Kate Atkinson, Death at the Sign of the Rook, the Booker Prize-nominated The Garden of Evening Mists by Tan Twan Eng, and Jon Dunn's monograph on the hummingbird, The Glitter in the Green. For episode show notes, please see the Slightly Foxed website. Opening music: Preludio from Violin Partita No. 3 in E Major by Bach Hosted by Rosie Goldsmith Produced by Philippa Goodrich