Podcasts about Limpopo

The northernmost province of South Africa

  • 299PODCASTS
  • 1,904EPISODES
  • 15mAVG DURATION
  • 5WEEKLY NEW EPISODES
  • Dec 23, 2025LATEST
Limpopo

POPULARITY

20192020202120222023202420252026

Categories



Best podcasts about Limpopo

Show all podcasts related to limpopo

Latest podcast episodes about Limpopo

Update@Noon
N1 road outside Louis Trichardt in Limpopo, has been closed off

Update@Noon

Play Episode Listen Later Dec 23, 2025 4:41


The N1 road outside Louis Trichardt in Limpopo, has been closed following a crash which involved four vehicles. A truck, a bus, a sedan and bakkie collided with each other. According to eye witnesses, the bus driver allegedly ignored a stop-and-go sign and lost control and crashed into other vehicles. Sakina Kamwendo caught with our reporter Rudzani Tshivhase...

closed n1 limpopo louis trichardt
Farmer's Inside Track
Maximising poultry feed

Farmer's Inside Track

Play Episode Listen Later Dec 22, 2025 15:08


In this episode of Farmer's Inside Track, Limpopo poultry farmer and agripreneur Kamogelo Thobejane shares practical, experience-driven tips to help South African producers maximise every kilogram of poultry feed. From understanding protein, vitamins, minerals and age-specific formulations to spotting poor-quality feed, preventing spillage, adjusting feeders, and avoiding costly mistakes like constant brand switching, Kamogelo breaks down the essentials of efficient, profitable broiler and layer production. Whether you're a new or seasoned poultry farmer, this episode offers clear, actionable guidance to improve bird performance.

Nuus
Limpopo-sakeman lewenslank tronk vir moord op vrou

Nuus

Play Episode Listen Later Dec 20, 2025 0:16


Die Hooggeregshof in Polokwane het 'n sakeman van Limpopo, Rameez Patel, tot lewenslange tronkstraf gevonnis vir die moord op sy vrou, Fatima, in 2015. Hy het ook vyf jaar ontvang vir die onwettige besit van 'n vuurwapen en drie jaar vir ammunisie. Regter Joseph Raulinga het bevind Patel het geen berou getoon nie en bewerings dat daar indringers was verwerp. Die streekswoordvoerder van die Nasionale Vervolgingsgesag, Mashudu Malabi, het die vonnis verwelkom as 'n sterk standpunt teen geslagsgeweld:

patel hy limpopo moord polokwane nasionale vervolgingsgesag
The Best of Weekend Breakfast
Future Of: The future of energy research with Keletso Monareng

The Best of Weekend Breakfast

Play Episode Listen Later Dec 20, 2025 21:15 Transcription Available


Gugs Mhlungu speaks with Keletso Monareng, PhD candidate in Physics at the University of Limpopo and winner of the 2025 L’Oréal-UNESCO For Women in Science Award, about her groundbreaking research on sodium-ion batteries, the motivation behind developing sustainable battery technology, how sodium batteries work, and the potential impact of her work on the future of clean energy. 702 Weekend Breakfast with Gugs Mhlungu is broadcast on 702, a Johannesburg based talk radio station, on Saturdays and Sundays Gugs Mhlungu gets you ready for the weekend each Saturday and Sunday morning on 702. She is your weekend wake-up companion, with all you need to know for your weekend. The topics Gugs covers range from lifestyle, family, health, and fitness to books, motoring, cooking, culture, and what is happening on the weekend in 702land. Thank you for listening to a podcast from 702 Weekend Breakfast with Gugs Mhlungu. Listen live on Primedia+ on Saturdays and Sundays from 06:00 and 10:00 (SA Time) to Weekend Breakfast with Gugs Mhlungu broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/u3Sf7Zy or find all the catch-up podcasts here https://buff.ly/BIXS7AL Subscribe to the 702 daily and weekly newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702See omnystudio.com/listener for privacy information.

Notizen aus aller Welt
Notizen aus Südafrika: From Limpopo to the World

Notizen aus aller Welt

Play Episode Listen Later Dec 17, 2025 14:29


Gegründet hat sich der Ndlovu Youth Choir im Jahr 2009 in Limpopo im Norden von Südafrika. In diesem Jahr ist er so richtig bekannt geworden, als er die "Bohemian Rhapsody" von Queen in ihrer Sprache Zulu herausbrachte.

Farmer's Inside Track
Desry Lesele: Finance guru empowering SA farmers

Farmer's Inside Track

Play Episode Listen Later Dec 15, 2025 21:05


In this episode, chartered accountant Desry Lesele, driven by his Limpopo farm roots and role as Nedbank's senior agriculture manager, shows farmers how to conquer rising costs, weather volatility, and tight margins with tailored financial tools for growth and resilience.From witnessing his grandmother's struggles growing sorghum and maize, Lesele crafts solutions against input price surges, grain oversupply, and climate threats risking 40% yield losses, urging early banker ties, tech investments, and diversification.He insists that farmers should treat farming as a business by tracking records, planning strategically, and using finance as a survival edge for food security and rural jobs.

Update@Noon
N3 Top Festive Priority Route

Update@Noon

Play Episode Listen Later Dec 12, 2025 9:33


Transport Minister Barbara Creecy is leading an inter-provincial law enforcement operation aimed at road users travelling between Gauteng, Limpopo, and North West during this festive season. Last month the Minister officially launched the 365-day Arrive Alive Road Safety Campaign. She has called on all South Africans to take personal responsibility for reducing crashes and fatalities on the country's roads as the 2025/26 festive season begins. Bongiwe Zwane spoke to Deputy Transport Minister Mkhuleko Hlengwa

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Dec 12, 2025 5:32


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Nuus
Net 31% van SA inwoners het baie vertroue in regering

Nuus

Play Episode Listen Later Dec 11, 2025 0:17


Die 2025 Suid-Afrikaanse Versoeningsbarometer toon slegs 31-persent van burgers het baie vertroue in die Regering van Nasionale Eenheid met 34-persent wat min vertroue toon. 'n Navorser, Kate Lefko-Everett, sê vertroue is in die Wes-Kaap, Noordwes en Limpopo die hoogste en die laagste in die Noord-Kaap, KwaZulu-Natal en die Vrystaat. Sy verbind dié gemengde resultate aan bestuur, dienslewering en aanspreeklikheid want armoede en ongelykheid is steeds groot struikelblokke:

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Dec 9, 2025 4:25


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Farmer's Inside Track
Inside Limpopo's farming transformation: Subtrop & Nedbank's impact

Farmer's Inside Track

Play Episode Listen Later Dec 5, 2025 25:42


In part 3 of our special Farmer's Inside Track series with Nedbank, we explore how Subtrop is transforming the lives and businesses of emerging farmers in Limpopo. Subtrop's transformation manager, Stephen Mantsho, breaks down the organisation's practical approach — from technical training and Global GAP accreditation to improved market access and the rise of black-owned packhouses and processing facilities. With Nedbank's support, farmers in regions like Vhembe and Mopani are scaling from small plots to profitable commercial operations, proving that meaningful, sustainable agricultural transformation is not only possible but already underway.

First Take SA
AFRICA BRIEF with Victor Kgomoewana

First Take SA

Play Episode Listen Later Dec 5, 2025 5:06


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Farmer's Inside Track
How SoilSistas empowers women farmers in South Africa

Farmer's Inside Track

Play Episode Listen Later Dec 3, 2025 5:41


SoilSistas, a partnership between Corteva Agriscience and GIBS, proudly celebrates 50 empowered women farmers graduating this year. The 12-month programme equips rural women with sustainable farming, financial literacy, and business skills to overcome barriers and boost food security. Graduates like Dora Masehela from Limpopo testify to the powerful mix of classroom learning and hands-on training, enabling them to build profitable, community-focused farms. SoilSistas is transforming lives and landscapes, nurturing women as both farmers and leaders ready to grow South Africa's agricultural future.

Road Trip's Podcast - Travel, Touring and Holidays in South Africa

Send us a textAn emotive issue - Hunting and Trophy Hunting. As you drive through South Africa - particularly in Northern KZN, Mpumalanga, North West, Limpopo, and now the Eastern Cape as well - you pass kilometres of high electrified fencing.These are what we call "Game Farms" - aimed at tourism and hunting. We explore the topic and the importance of this industry to South Africa.Some resources:https://africageographic.com/stories/botswana-elephant-hunting-under-scientific-review/?utm_source=Africa+Geographic&utm_campaign=426952b838-AGNewsletter_November_04_2025_resend&utm_medium=email&utm_term=0_32007fbc2b-426952b838-292991874&mc_cid=426952b838&mc_eid=d520cdf556https://news.nwu.ac.za/r15456-billion-private-wildlife-hunting-means-big-buckshttps://businesstech.co.za/news/business/206214/how-much-you-pay-to-go-trophy-hunting-in-south-africa/The Road Trip SA app is available for downloadDo you want to visit and explore South Africa? Touch Africa Safaris

Road Trip's Podcast
Hunting in South Africa

Road Trip's Podcast

Play Episode Listen Later Dec 2, 2025 57:24


Send us a textAn emotive issue - Hunting and Trophy Hunting. As you drive through South Africa - particularly in Northern KZN, Mpumalanga, North West, Limpopo, and now the Eastern Cape as well - you pass kilometres of high electrified fencing.These are what we call "Game Farms" - aimed at tourism and hunting. We explore the topic and the importance of this industry to South Africa.Some resources:https://africageographic.com/stories/botswana-elephant-hunting-under-scientific-review/?utm_source=Africa+Geographic&utm_campaign=426952b838-AGNewsletter_November_04_2025_resend&utm_medium=email&utm_term=0_32007fbc2b-426952b838-292991874&mc_cid=426952b838&mc_eid=d520cdf556https://news.nwu.ac.za/r15456-billion-private-wildlife-hunting-means-big-buckshttps://businesstech.co.za/news/business/206214/how-much-you-pay-to-go-trophy-hunting-in-south-africa/The Road Trip SA app is available for downloadDo you want to visit and explore South Africa? Touch Africa Safaris

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Dec 2, 2025 4:26


Elvis Presslin takes a look at the current top African economic stories. with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Spektrum
Spektrum 28 November 2025

Spektrum

Play Episode Listen Later Nov 28, 2025 45:17


Die Madlanga-kommissie se aandag wend terug na die 121 misdaaddossiere wat van Durban na Gauteng verskuif is. Die EFF eis die vrystelling van die Konstitusionele Hof se uitspraak oor die diefstalskandaal by president Cyril Ramaphosa se plaas in Limpopo. Die jongste misdaadstatistiek word ná twee keer se uitstel, bekendgemaak.

Nuus
RISE het kommer oor 20% van polisiestasies wat onbewoonbaar is

Nuus

Play Episode Listen Later Nov 26, 2025 0:19


RISE Mzansi het sy kommer uitgespreek dat ongeveer 118 uit 1 165 polisiestasies as onbewoonbaar geklassifiseer word. Waarnemende polisieminister, Firoz Cachalia het vroeër gesê die stasies wat die meeste geraak word, is in Noordwes, Limpopo en KwaZulu-Natal - almal in gebiede wat hoë misdaad beveg. Hy het 35 beplande opgraderings aangekondig, insluitend nuwe bouwerk en herstelwerk, gerugsteun deur 'n begroting van 305 miljoen Suid-Afrikaanse rand. Makashule Gana van RISE Mzansi doen 'n beroep op toesigbesoeke om behoorlike besteding en veiliger werksomstandighede te verseker:

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 25, 2025 4:16


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 21, 2025 4:29


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 18, 2025 3:23


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Farmer's Inside Track
How Andries Masoga built a thriving agribusiness

Farmer's Inside Track

Play Episode Listen Later Nov 17, 2025 44:43


In this inspiring episode, we sit down with Andries Masoga of Mazeli Farming and Projects, a family-run agribusiness in Limpopo that grew from a small backyard garden into a thriving 140-hectare enterprise. Andries shares how his wife, Tsakani Masoga's passion for home gardening sparked a journey that now spans tomatoes, potatoes, butternut, and peppadew under formal offtake agreements with major companies, such as PepsiCo and Peppadew International. From their first 10 hectares granted by the local traditional council to employing over 160 local workers, the Masoga family's story is one of impact. Tune in to hear how they have built a legacy grounded in family succession and rural transformation.

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 14, 2025 4:39


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

The Daily Friend Show
Has South Africa turned the corner?

The Daily Friend Show

Play Episode Listen Later Nov 13, 2025 34:09


Today's Show with Makone Maja and Nicholas Lorimer discusses the latest budget news. They also discuss the NPA and water problems in Limpopo. Website · Facebook · Instagram · Twitter

First Take SA
October 2025 was one of the wettest months on record for South Africa

First Take SA

Play Episode Listen Later Nov 13, 2025 10:55


October 2025 was one of the wettest months on record for South Africa, with some areas receiving over four times their average rainfall. This according to a recent report compiled by the South African Weather Service. The heavy rains have had a significant impact on agriculture, water management, and communities across the country, particularly in provinces like Limpopo, North West, Free State and Mpumalanga. Elvis Presslin spoke to Rudzani Malala, Senior Manager for Disaster Risk Reduction at the South African Weather Service

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 11, 2025 3:36


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

The Weekend View
G20 Health Ministers' meeting concludes with US refusing to sign declaration

The Weekend View

Play Episode Listen Later Nov 8, 2025 8:39


In the build-up to this month's G20 Summit in Johannesburg, The Weekend View brings you a series of interviews on some of South Africa's key priorities as it prepares to host the global conference. Today, we zoom in on the just-concluded G20 health ministers meeting which was held in Polokwane, Limpopo. The meeting ended with no signed declaration as the United States disagreed with the majority of the key priorities tabled by the G20 group of nations. Some of the key discussions focused on ensuring meaningful progress towards ending HIV/AIDS the year 2030. For more on this, Bongiwe Zwane spoke to National Health Insurance Technical Specialist at the Department of Health, Dr Aquina Thulare

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 7, 2025 4:18


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

Nuus
Landboudepartement waarsku oor hondsdolheid

Nuus

Play Episode Listen Later Nov 5, 2025 0:17


Die Departement van Landbou het 'n waarskuwing uitgereik oor hoërisikogebiede vir hondsdolheid in Suid-Afrika, waar die siekte onder honde, Kaapse pelsrobbe en ander soogdiere voorkom. Hondsdolheid is 'n dodelike virussiekte wat alle soogdiere aantas en in die speeksel van besmette diere na mense kan versprei. Die departement se woordvoerder, Prince Mtsweni, sê daar was vanjaar menslike sterftes in KwaZulu-Natal, die Oos-Kaap en Limpopo wat toegeskryf kan word aan hondsdolheid:

First Take SA
AUBBTA plans to file criminal charges against the Transport minister, her deputy & others

First Take SA

Play Episode Listen Later Nov 5, 2025 6:06


The African Unite Borders Bus Trucks Association, AUBBTA has announced plans to file criminal charges against Transport Minister Barbara Creecy, her deputy Mkhuleko Hlengwa and officials at the Cross-Border Road Transport Agency. The move stems from last month's deadly bus crash near Makhado in Limpopo which claimed 43 lives, mostly Zimbabwean and Malawian nationals. Elvis Presslin spoke to AUBBTA Chairperson, Mukhwathi Phumudzo

First Take SA
AFRICA BRIEF with Victor Kgomoeswana

First Take SA

Play Episode Listen Later Nov 4, 2025 5:02


Elvis Presslin takes a look at the current top African economic stories with Victor Kgomoeswana, author of "Africa Is Open For Business" and "Africa Bounces Back". Victor is also the Executive Director for Marketing and Communication at the University of Limpopo

The Best of Azania Mosaka Show
The Upside of Failure with Clement Maosa

The Best of Azania Mosaka Show

Play Episode Listen Later Oct 24, 2025 33:42 Transcription Available


Relebogile Mabotja speaks to the Award-winning actor and musician, Clement Maosa best known for his role as Zamokuhle "Kwaito" on Skeem Saam about his acting career, growing up in Limpopo and the lessons he has learned from failure. 702 Afternoons with Relebogile Mabotja is broadcast live on Johannesburg based talk radio station 702 every weekday afternoon. Relebogile brings a lighter touch to some of the issues of the day as well as a mix of lifestyle topics and a peak into the worlds of entertainment and leisure. Thank you for listening to a 702 Afternoons with Relebogile Mabotja podcast. Listen live on Primedia+ weekdays from 13:00 to 15:00 (SA Time) to Afternoons with Relebogile Mabotja broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/2qKsEfu or find all the catch-up podcasts here https://buff.ly/DTykncj Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 See omnystudio.com/listener for privacy information.

Radio Islam
Limpopo Bus Tragedy Exposes South Africa's Failing Road Safety Practices | Johan Jonck

Radio Islam

Play Episode Listen Later Oct 14, 2025 6:25


Limpopo Bus Tragedy Exposes South Africa's Failing Road Safety Practices | Johan Jonck by Radio Islam

The Clement Manyathela Show
#702Openline: A dark day on the N1, 42 fatalities in Limpopo bus crash

The Clement Manyathela Show

Play Episode Listen Later Oct 13, 2025 41:19 Transcription Available


Clement Manyathela speaks with the listeners on the 42 fatalities in a horrific bus crash on the N1 highway in Limpopo. They touch on the precautions that should be taken by bus companies, they also reflect on what the expectations are with the testimony of Shadrack Sibiya at the ad-hoc commission in parliament. The Clement Manyathela Show is broadcast on 702, a Johannesburg based talk radio station, weekdays from 09:00 to 12:00 (SA Time). Clement Manyathela starts his show each weekday on 702 at 9 am taking your calls and voice notes on his Open Line. In the second hour of his show, he unpacks, explains, and makes sense of the news of the day. Clement has several features in his third hour from 11 am that provide you with information to help and guide you through your daily life. As your morning friend, he tackles the serious as well as the light-hearted, on your behalf. Thank you for listening to a podcast from The Clement Manyathela Show. Listen live on Primedia+ weekdays from 09:00 and 12:00 (SA Time) to The Clement Manyathela Show broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/XijPLtJ or find all the catch-up podcasts here https://buff.ly/p0gWuPE Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 See omnystudio.com/listener for privacy information.

Round The Fire With Kingsview Safaris
Ep 98: Devin Trimarchi - Hunting In Limpopo, South Africa

Round The Fire With Kingsview Safaris

Play Episode Listen Later Oct 10, 2025 83:50


My guest on the latest episode is Devin from Kansas City and we had a great chat, covering all sorts of topics from how he chose his outfitter, bringing over your own rifle, the importance of not sticking to a list, trusting yourself to pull of a quick 'hail Mary' shot, plus Devin gave some fantastic advice for those planning their first trip to Africa.   If you are enjoying these episodes and getting some value out of them, then do me a massive favour and take a few seconds to leave a review and rating on Apple podcasts and Spotify. Thanks!   Get in touch with Devin or follow along on his hunting journeys on his instagram: @celebratory_gunfire  

BizNews Radio
The Electoral Road Show with Wayne Sussman: ANC wobbling, DA improving, PA climbing fast

BizNews Radio

Play Episode Listen Later Oct 9, 2025 12:24


After over a year of by-elections since the national election, Elections Analyst Wayne Sussman gives Chris Steyn an update of the latest shifts in the political landscape. “One of the trends we continue to see is that the ANC candidates for council in provinces like the Eastern Cape and Limpopo will know that they are very likely to hold on to their seats come the election next year. The party which should be happiest right now is probably the Patriotic Alliance because they've shown a continued growth of trajectory. But you're also seeing a party like the DA starting to put in good performances.” Previewing the next round of by-elections, Sussman warns that the ANC - that had a “very sharp fall” in a recent Soweto by-election - will face the “Chasing Pack” in the upcoming one; “the bragging rights for second place or even third place, because between MK, EFF, Patriotic Alliance, ActionSA and the DA…only five percentage points separated party two to six. So it's a real scrum in that Chasing Pack. And I think the pecking order is going to be very important.” Sussman also describes how the DA managed to edge out the ANC in Ga-Nala Mpumalanga. “The key municipality of eMahlahleni is now hung because the ANC has lost its outright majority.” He also dissects all the other recent results along with the prospects of the parties in the next round.

The Aubrey Masango Show
Profile Interview: Profiling Refiloe Nkadimeng, CFO of African Rainbow Capital

The Aubrey Masango Show

Play Episode Listen Later Oct 3, 2025 44:04 Transcription Available


Aubrey Masango speaks to Refiloe Nkadimeng, CFO of African Rainbow Capital exploring her work and growth in the financial space. They touch on her upbringing, how it has shaped the person she has become.Tags: 702, The Aubrey Masango Show, Aubrey Masango, Profile Interview, Refiloe Nkadimeng, Finances, African Rainbow Capital. Limpopo, Inspiration The Aubrey Masango Show is presented by late night radio broadcaster Aubrey Masango. Aubrey hosts in-depth interviews on controversial political issues and chats to experts offering life advice and guidance in areas of psychology, personal finance and more. All Aubrey’s interviews are podcasted for you to catch-up and listen. Thank you for listening to this podcast from The Aubrey Masango Show. Listen live on weekdays between 20:00 and 24:00 (SA Time) to The Aubrey Masango Show broadcast on 702 https://buff.ly/gk3y0Kj and on CapeTalk between 20:00 and 21:00 (SA Time) https://buff.ly/NnFM3Nk Find out more about the show here https://buff.ly/lzyKCv0 and get all the catch-up podcasts https://buff.ly/rT6znsn Subscribe to the 702 and CapeTalk Daily and Weekly Newsletters https://buff.ly/v5mfet Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.

The Live for Yourself Revolution Podcast: Living toward greater health, wealth, and happiness

After selling her first travel company Under Canvas in 2018, for more than $100 million, Sarah Dusek launched Enygma Ventures a US based venture capital fund to invest in Africa's talented female entrepreneurs and contribute towards rectifying the great funding imbalance.Over the last 5 years Sarah's work has impacted over 10,000 entrepreneurs who have gone through Enygma's investor-ready programs to learn how to build valuable, companies, demystify the complicated and often inaccessible world of funding. In her new book “Thinking Bigger: A Pitch Deck Formula For Women Who Want To Change the World”, Sarah shares the challenges of her own journey building a $100 million company and shares the critical building blocks needed to scale any business.Today Sarah is the CoFounder & CEO of Few & Far, a net positive travel/climate company investing in large scale regeneration of landscapes, carbon sequestration and creating extraordinary travel experiences.She recently opened her newest lodge Few & Far Luvhondo, set the Soutpansberg mountains of Limpopo, South Africa – an area larger than Singapore which represents 100,000 hectares of incredible biodiversity but remains under serious threat from mining claims and deforestation.Sarah aims to reimagine the safari experience by pioneering the world's first aerial safari and creating very unique experiences in this remote part of South Africa. Sarah believes business can be, and should, be a force for good driving our world forward.Links to include: www.fewandfarluvhondo.com

The Clement Manyathela Show
Did the Limpopo Legislature spend 1.8 million for PhD title on flight ticket?

The Clement Manyathela Show

Play Episode Listen Later Sep 29, 2025 7:07 Transcription Available


Clement Manyathela speaks to Andries Lekalakala, the Head of Communication for the Limpopo Legislature to discuss the controversy surrounding the insistence of a Limpopo Legislature executive in adding a PhD title on his flight ticket to the Gambia.The Clement Manyathela Show is broadcast on 702, a Johannesburg based talk radio station, weekdays from 09:00 to 12:00 (SA Time). Clement Manyathela starts his show each weekday on 702 at 9 am taking your calls and voice notes on his Open Line. In the second hour of his show, he unpacks, explains, and makes sense of the news of the day. Clement has several features in his third hour from 11 am that provide you with information to help and guide you through your daily life. As your morning friend, he tackles the serious as well as the light-hearted, on your behalf. Thank you for listening to a podcast from The Clement Manyathela Show. Listen live on Primedia+ weekdays from 09:00 and 12:00 (SA Time) to The Clement Manyathela Show broadcast on 702 https://buff.ly/gk3y0Kj For more from the show go to https://buff.ly/XijPLtJ or find all the catch-up podcasts here https://buff.ly/p0gWuPE Subscribe to the 702 Daily and Weekly Newsletters https://buff.ly/v5mfetc Follow us on social media: 702 on Facebook https://www.facebook.com/TalkRadio702 702 on TikTok https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702See omnystudio.com/listener for privacy information.

BizNews Radio
Wayne Sussman: Municipal rule by the gun…

BizNews Radio

Play Episode Listen Later Sep 4, 2025 19:30


In his latest interview with Chris Steyn, elections analyst Wayne Sussman gives the backstory to gunmen taking control of a municipal council in Northwest where different factions of the African National Congress (ANC) are backing different mayors. “…this crazy scenario of the rival factions having gunmen in the municipality, gunmen near a council chamber, near the engine of this municipality, is greatly concerning, not just for our democracy, but also for service delivery in South Africa,” Sussman says. Furthermore, at least 148 municipal officials have been murdered since 2018 - and two by-elections in the space of seven days are because of assassinations. “… people resort to literally killing their opponents,” he says. Sussman gives an in-depth analyses of the by-election results of the last two rounds with trends showing that the Patriotic Alliance continues to “do a lot of damage” to the ANC, but that its support remains “absolutely rock solid" in Limpopo and in the Eastern Cape. Meanwhile, the Democratic Alliance had a “morale boosting" victory in the Northern Cape.

Nuus
Sandmyne by Sandrivier beskadig die omgewing

Nuus

Play Episode Listen Later Aug 29, 2025 0:15


Die DA in Limpopo sê onwettige sandmynbou langs die Sandrivier benadeel die omgewing, die watergehalte en boere se lewensbestaan. Boere en landelike gemeenskappe ondervind ernstige probleme met besproeiing en toegang tot water. Die party sê dit lyk asof baie bedrywighede die behoorlike openbare deelnameprosesse omseil het. Die DA-lid, Jacques Smalle, belowe om dringende optrede aan te moedig om die rivier en omliggende ekostelsels te beskerm:

The Daily Friend Show
People look at the ANC "With horror and shame"

The Daily Friend Show

Play Episode Listen Later Aug 25, 2025 28:37


Nicholas Lorimer and Terence Corrigan discuss the growing evidence that the ANC is in big trouble in the next municipal election. They also discuss a shocking lack of resources in the South African Police Service and a legacy of broken promises in the Limpopo village. Website · Facebook · Instagram · Twitter

Afternoons with Pippa Hudson
On the couch: SA Tea grower unlocks the chemistry of tea

Afternoons with Pippa Hudson

Play Episode Listen Later Aug 25, 2025 14:47 Transcription Available


Pippa speaks to Retang Phaahla, the founder and CEO of a business called Setsong Tea Crafters. She’s a tea crafter who is drawing on indigenous botanical knowledge to create jobs and drive tourism in rural Limpopo. Lunch with Pippa Hudson is CapeTalk’s mid-afternoon show. This 2-hour respite from hard news encourages the audience to take the time to explore, taste, read and reflect. The show - presented by former journalist, baker and water sports enthusiast Pippa Hudson - is unashamedly lifestyle driven. Popular features include a daily profile interview #OnTheCouch at 1:10pm. Consumer issues are in the spotlight every Wednesday while the team also unpacks all things related to health, wealth & the environment. Thank you for listening to a podcast from Lunch with Pippa Hudson Listen live on Primedia+ weekdays between 13:00 and 15:00 (SA Time) to Lunch with Pippa Hudson broadcast on CapeTalk https://buff.ly/NnFM3Nk For more from the show go to https://buff.ly/MdSlWEs or find all the catch-up podcasts here https://buff.ly/fDJWe69 Subscribe to the CapeTalk Daily and Weekly Newsletters https://buff.ly/sbvVZD5 Follow us on social media: CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.

The Aubrey Masango Show
Entrepreneurship feature: The Real Makoya cleaning detergents Founder, Lebohang Moloto

The Aubrey Masango Show

Play Episode Listen Later Aug 12, 2025 40:56 Transcription Available


Kgomotso Modise standing in for Aubrey Masango chats to Lebohang Moloto, the founder of The Real Makoya Detergent as they discuss what it takes in starting a business, what goes into making one’s business a success and we will also get to hear her future aspirationsTags: 702, Aubrey Masango show, Aubrey Masango, Kgomotso Modise, The Real Makoya cleaning detergent, Lebohang Moloto, Limpopo, Spar, Makro, OK supermarket, Cleaning detergent The Aubrey Masango Show is presented by late night radio broadcaster Aubrey Masango. Aubrey hosts in-depth interviews on controversial political issues and chats to experts offering life advice and guidance in areas of psychology, personal finance and more. All Aubrey’s interviews are podcasted for you to catch-up and listen. Thank you for listening to this podcast from The Aubrey Masango Show. Listen live on weekdays between 20:00 and 24:00 (SA Time) to The Aubrey Masango Show broadcast on 702 https://buff.ly/gk3y0Kj and on CapeTalk between 20:00 and 21:00 (SA Time) https://buff.ly/NnFM3Nk Find out more about the show here https://buff.ly/lzyKCv0 and get all the catch-up podcasts https://buff.ly/rT6znsn Subscribe to the 702 and CapeTalk Daily and Weekly Newsletters https://buff.ly/v5mfet Follow us on social media: 702 on Facebook: https://www.facebook.com/TalkRadio702 702 on TikTok: https://www.tiktok.com/@talkradio702 702 on Instagram: https://www.instagram.com/talkradio702/ 702 on X: https://x.com/Radio702 702 on YouTube: https://www.youtube.com/@radio702 CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.

Nuus
Suid-Afrika herdenk Vrouedag

Nuus

Play Episode Listen Later Aug 8, 2025 0:15


Suid-Afrika herdenk vandag Vrouedag en die regering sê hierdie jaar kyk na die vordering wat vroue gemaak het in leierskap en die ekonomiese lewe, en die stryd teen geslagsgeweld. Die 2025 Nasionale Vrouedag-vieringe met die tema “Die bou van veerkragtige ekonomieë vir almal" sal by die Nkowankowa Stadion in Tzaneen, Limpopo, gehou word. Die minister in die Presidensie, Khumbudzo Ntshavheni sê Vrouemaand is 'n oproep tot aksie vir volledige en gelyke deelname in die vorming van Suid-Afrika se toekoms:

limpopo suid afrika khumbudzo ntshavheni
Nuus
Aanlynafspraak-reeksverkragter in Limpopo vasgetrek

Nuus

Play Episode Listen Later Aug 5, 2025 0:19


'n 37-jarige aanlyn-afspraakreeksverkragter en -moordenaar, wat aan meer as tien sake in Eersterust, Pretoria, verbind word, is in Limpopo in hegtenis geneem. Die verdagte het 'n gewilde afspraak-webwerf gebruik om sy vroulike slagoffers na sy woning in Eersterust te lok. 'n Polisiewoordvoerder, Malesela Ledwaba, sê hy het na bewering sommige van sy slagoffers verkrag, tot die mees onlangse voorval toe hy die slagoffer na bewering verkrag en vermoor het, en haar daarna in 'n vlak graf by sy woning begrawe het:

The Nurse Keith Show
The Impact of Competency-Based Education in Nursing

The Nurse Keith Show

Play Episode Listen Later Jul 30, 2025 41:41


On episode 523 of The Nurse Keith Show nursing and healthcare career podcast, Keith interviews author, nursing educator, and researcher Dr. Ruth Wittmann-Price, PhD, RN, CNS, CNE, CNEcl, CHSE, ANEF, FAAN. In the course of their conversation, Keith and Dr. Wittmann-Price discuss the importance and impact of competency-based education in nursing. Dr. Wittmann-Price also reflects on her storied career, and her perceptions and experiences as a highly accomplished nurse academician and writer. Ruth A. Wittmann-Price, PhD, RN, CNS, CNE, CNEcl, CHSE, ANEF, FAAN, is Dean of the W. Cary Edwards School of Nursing and Health Professionals at Thomas Edison State University in Trenton, NJ. Ruth has been an obstetrical/women's health nurse for 47 years. Dr. Wittmann-Price received her AAS and BSN degrees from Felician College, Lodi, New Jersey, and her MS as a perinatal clinical nurse specialist (CNS) from Columbia University, New York, New York. She completed her PhD in nursing at Widener University, Chester, Pennsylvania, and received the Dean's Award for Excellence. Ruth developed a mid-range nursing theory, “Emancipated Decision-Making in Women's Health Care,” and has tested her theory in four research studies. International researchers are currently using her theory as the foundation for their studies. Her theory is being used by researchers at the University of Limpopo, South Africa, in their campaign, “Finding Solutions for Africa,” which helps women and children. Dr. Wittmann-Price has taught all levels of nursing students over the past 30 years and has completed international service-learning trips. She has coedited or authored 16 books, contributed many chapters, and written numerous articles. She has presented her research regionally, nationally, and internationally. Dr. Wittmann-Price was inducted into the National League for Nursing Academy of Nurse Educator Fellows in 2013 and became a fellow in the American Academy of Nursing in October 2015. This episode of the Nurse Keith Show is brought to you in collaboration with Springer Publishing, who have been delivering award-winning healthcare education and exam prep materials focused on nursing, behavioral health, and the health sciences for more than 70 years. We thank Springer Publishing for their support. Links: ⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠⁠Fast Facts About Competency-Based Education in Nursing: How to Teach Competency Mastery Certified Nurse Educator Review, 4th Edition Springer Publishing Contact Nurse Keith about holistic career coaching to elevate your nursing and healthcare career at ⁠⁠⁠⁠⁠⁠⁠NurseKeith.com⁠⁠⁠⁠⁠⁠⁠. Keith also offers services as a motivational and keynote speaker and freelance nurse writer. You can always find Keith on⁠⁠⁠⁠⁠⁠⁠ LinkedIn⁠⁠⁠⁠⁠⁠⁠. Are you looking for a novel way to empower your career and move forward in life? Keith's wife, Shada McKenzie, is a gifted astrologer and reader of the tarot who combines ancient and modern techniques to provide valuable insights into your motivations, aspirations, and life trajectory, and she offers listeners of The Nurse Keith Show a 10% discount on their first consultation. Contact Shada at ⁠⁠⁠⁠⁠⁠⁠TheCircelandtheDot.com ⁠⁠⁠⁠⁠⁠⁠or shada@thecircleandthedot.com.

Nuus
SA moet burgers, nie buitelanders nie, bevoordeel

Nuus

Play Episode Listen Later Jul 29, 2025 0:20


ActionSA sê Suid-Afrika se bemagtigingsagenda moet aanhou fokus op die behoeftes van Suid-Afrikaners en nie buitelandse burgers bevoordeel nie. Die party sê die Polokwane plaaslike munisipaliteit in Limpopo het die afgelope twee boekjare tenders ter waarde van ongeveer 200-miljoen Suid-Afrikaanse rand aan buitelandse ondernemings toegeken. Tshepo Magoma van ActionSA sê die doel van swart ekonomiese bemagtiging is om geskiedkundige ongeregtighede reg te stel en voorheen-benadeelde Suid-Afrikaanse burgers te bemagtig:

Blood Origins
Episode 578 - John Luyt || Limpopo Elephant Hunting Update

Blood Origins

Play Episode Listen Later Jul 24, 2025 31:40


John Luyt is one of the professional hunters that works in the APNR - the Associated Private Nature Reserves of the Kruger National Park. These reserves were setup to incorporate into Kruger National Park and allow for more movement of wildlife. With the dropping of fences, Kruger's burgeoning elephant population has spilled into the APNR, where legal, highly regulated hunting of elephants occurs. The hunting of elephants in this area has gone through significant upheaval since 2021, when Humane Society International put a court interdict in place stopping export of elephant trophies. Today, we get a huge step forward towards returning to pre-2021. John brings Robbie breaking news out of the Limpopo Province of South Africa that now, for the first time in quite some time, international hunters may now hunt nonexportable elephants in the Limpopo Province, along with a history of why this is such a significant clawback of ground after several battles in and out of court. Get to know the guest: https://www.instagram.com/johnluyt/?hl=en Do you have questions we can answer? Send it via DM on IG or through email at info@bloodorigins.com Support our Conservation Club Members! Bar JP Safaris: https://www.barjpsafaris.com/  Cabassa Safaris: https://cabassasafaris.com/  Robin Hurt Safaris Namibia: https://www.robinhurt.com/hunting-safaris-namibia.html  See more from Blood Origins: https://bit.ly/BloodOrigins_Subscribe Music: Migration by Ian Post (Winter Solstice), licensed through artlist.io This podcast is brought to you by Bushnell, who believes in providing the highest quality, most reliable & affordable outdoor products on the market. Your performance is their passion. https://www.bushnell.com  This podcast is also brought to you by Silencer Central, who believes in making buying a silencer simple and they handle the paperwork for you. Shop the largest silencer dealer in the world. Get started today! https://www.silencercentral.com  This podcast is brought to you by Safari Specialty Importers. Why do serious hunters use Safari Specialty Importers? Because getting your trophies home to you is all they do. Find our more at: https://safarispecialtyimporters.com  Learn more about your ad choices. Visit megaphone.fm/adchoices

Sober Cast: An (unofficial) Alcoholics Anonymous Podcast AA
ESH: Doug R - Limpopo AA Rally South Africa

Sober Cast: An (unofficial) Alcoholics Anonymous Podcast AA

Play Episode Listen Later Jul 13, 2025 36:51


Doug R telling his story at the Limpopo AA Rally South Africa Nov. 2012. Support Sober Cast: https://sobercast.com/donate Email: sobercast@gmail.com Sober Cast has 2900+ episodes available, visit SoberCast.com to access all the episodes where you can easily find topics or specific speakers using tags or search. https://sobercast.com