POPULARITY
Categories
Deux ans après avoir été suspendu pour des erreurs de localisation, Mehdi Frère est de retour. Et son retour est fracassant : victoire et record de l'épreuve sur le Adidas 10K Paris en 28'11. Dans cet épisode d'RMC Running, il raconte sans détour ce qu'il a traversé : les Jeux de Paris 2024 manqués, les critiques, les doutes, l'entraînement en solitaire, sans piste et sans compétition. Comment vit-on une telle épreuve ? Comment retrouver le plaisir, le niveau… et l'envie de rêver grand ? Mehdi se livre sur son come-back, ses ambitions sur marathon et son objectif ultime : les JO de Los Angeles 2028. Dans le bon plan dossard, RMC Running t'offre l'opportunité de participer aux différentes épreuves du MDS Crazy Loops : de la Rozière à Val d'Isère en passant par Courchevel et Avoriaz. Rendez-vous sur Instagram !
The Craziest Trip Ever by Rozi by 826 Valencia
Kahani Nikki, Rozi Aur Rani (Mera Pariwar) - Mahadevi Verma - कहानी निक्की,रोज़ी और रानी (मेरा परिवार)- महादेवी वर्मा - Suno Kahani #kahani #kahaniyan #mahadeviverma #sunokahani#mahadevivermakikahani #mahadevivermakikahaniyan #hindikahaniyan #hindistories #hindi #audiobook#mahadevivermakishreshthkahaniyan #mahadevivermakiprasidhkahaniyan
A Világtalálkozóban ezen a héten Lovas Rozi színésznő, a Loupe Színházi Társulás alapító tagja és Sz. Bíró Zoltán filozófiatörténész, egyetemi oktató, Oroszország szakértő érkezett hozzánk.
C'est quoi l'amour… pour vrai ?
Uzturēšanas atļaujas ir sabiedrības uzmanības fokusā jau ilgāku laiku. Bet ne tikai par to Krustpunktā izvaicājam Pilsonības un migrācijas lietu pārvaldes (PMLP) priekšnieci Mairu Rozi. Jautājumus kopā ar raidījuma vadītāju uzdod TV3 "Nekā personīga" žurnālists Juris Jurjāns un Latvijas TV žurnālists Dāvids Freidenfelds.
Uzturēšanas atļaujas ir sabiedrības uzmanības fokusā jau ilgāku laiku. Bet ne tikai par to Krustpunktā izvaicājam Pilsonības un migrācijas lietu pārvaldes (PMLP) priekšnieci Mairu Rozi. Jautājumus kopā ar raidījuma vadītāju uzdod TV3 "Nekā personīga" žurnālists Juris Jurjāns un Latvijas TV žurnālists Dāvids Freidenfelds.
Cette semaine sur le podcast, on reçoit Rozi du podcast Apéro Sexo pour une discussion ultra honnête sur les coulisses des podcasts, le dating moderne et la manière dont les conversations profondes transforment nos relations. On parle de préparation d'entrevues, de vulnérabilité, de sexualité et du contraste entre les discussions de surface et les vraies connexions humaines. Au programme: Pourquoi envoyer (ou non) les questions avant un podcast change complètement la dynamique La différence entre conversations profondes et “small talk” dans la vie réelle Le dating moderne, les red flags et pourquoi on se force à aller en deuxième date Le rôle du personal branding dans le succès d'un podcast Comment créer de vraies connexions humaines dans un monde rempli de conversations superficielles
Hogyan alakult ki az az izgalmas kettőség, hogy pszichothrillerként és politikai parabolaként is nézhető és élvezhető az Itt érzem magam otthon? Miért hangzik annyira viccesen Lovas Rozi szájából az, hogy „dugnak”? Tényleg azt akarták az alkotók, hogy Magyar Péterre és más magyar politikusokra gondoljunk a film közben? Egyáltalán, hogyan jutott el a kívülálló Holtai Gábor addig, hogy leforgathassa első nagyjátékfilmjét? Sok kérdésünk volt 2026 eddigi legmeglepőbb magyar közönségsikere kapcsán, a főszereplőt és a rendezőt hívtuk meg, hogy válaszokat kapjunk. A podcast végén a film fináléját is kitárgyaljuk.
(0:00) Intro(0:02) Khutba – Ikhtitam Surah A'araaf – Ibtida Surah Anfal(0:27) Surah A'araaf aur Surah Anfal ke Mauzu(0:44) Qaum-e-Shoaib AS ki Burai(1:45) Nahaqq Maal Khana(2:09) Naseehat(2:51) Visa aur Property ka Waqia(4:42) Clean Money Matters(5:30) Fans aur Digital Locks(6:08) Home AC(6:54) Jamia Tur Rasheed ka Waqia(7:50) Shoaib AS ki Dawati Strategy(10:49) Mutakabbir Sardaron ka Jawab(11:03) Maldar aur Ghareeb(12:22) Qaum ka Aitraaz(13:13) Deen aur Mushkilat(14:24) Fiqh ke Aham Abwaab(14:46) Dawat ki 2 Iqsam(15:04) Nabi ﷺ ka Farman(15:10) Tabligh ke 3 Darjat(15:50) Jihad ke 3 Darjat(15:56) Iqdami Jihad(17:47) Medan-e-Jang se Bhagna(18:01) Ghalat Ulema ka Jawab(18:46) Burai Roknay ka Sahih Tareeqa(19:31) Ambiya ka Tareeqa(21:29) Wahi ka Darwaza Band(21:49) Hamaray Liye Hukam(22:13) Zalim Hukmaran se Muqabla(22:37) Kamzor Jamat aur Qital(25:00) TV Scholars(26:11) Afghanistan ka Difai Jihad(26:58) Qaum-e-Shoaib ki Hatt Dharmi(27:06) Talkh Haqeeqat(28:04) Aam Insan aur Nabi ka Farq(28:39) Yunus AS ki Ijtehadi Ghalti(29:02) Merchant Navy ka Waqia(30:22) Ambiya ki Rozi(30:46) Ziada Fankar Banna(31:16) Hamaray Liye Hukam(31:43) Qaum-e-Shoaib ka Tang Aana(31:50) Nooh AS ka Hausla(32:28) Qaum-e-Shoaib ki Tabahi(33:52) Ummat-e-Muhammad ﷺ ke Liye Sabaq(34:52) Kuffar ki Bhool(35:44) Qaum-e-Shoaib ki Dhamki(36:41) Allah Sab se Pehle(36:51) Shoaib AS ka Murda Qaum se Khitab(38:14) Dushman aur Dost ki Pehchan(39:15) Khatoon ka Waqia(39:41) Kam Zarf (42:15) Pakistan mein Negativity(42:47) Shoaib AS ka Afsos Na Karna(43:21) New Karachi ka Waqia(44:18) Musa AS ka Waqia(44:37) Darbar-e-Firauon(45:27) Bani Israel ko Dawat(45:54) Bani Israel ki Tareekh(47:41) Muslim Minority se Hasad(48:24) Minorities aur Pakistan(49:14) Islam aur Muslims ka Growth(50:23) Africa ke Liye Mashwara(51:16) Yusuf AS aur Hasideen(52:17) Native Nations(52:33) Bani Israel ki Nasal Kushi(53:19) Family Planning Propaganda(55:08) Firauon ka Khwab(55:48) Firauon ka Zulm(56:01) Musa AS ki Demand(56:55) Darbariyon ka Reaction(57:46) Meetha(58:07) Aamilon ki Haqeeqat(58:55) Jadugaron se Muqabla(59:34) Bad-Gumani(1:00:45) Musa AS ke Qatal ki Sazish(1:01:10) Dua aur Khatma Hosted on Acast. See acast.com/privacy for more information.
Fluent Fiction - French: Élise's Winter Mission: Warming the Village with Hope Find the full episode transcript, vocabulary words, and more:fluentfiction.com/fr/episode/2026-01-17-23-34-02-fr Story Transcript:Fr: Dans le petit village de Rozières, l'hiver était bien installé.En: In the small village of Rozières, winter had settled in well.Fr: Les toits des maisons étaient recouverts de neige fraîche.En: The roofs of the houses were covered with fresh snow.Fr: Le jour commençait tranquillement et Élise, une dame âgée mais pleine d'énergie, se préparait.En: The day started quietly, and Élise, an elderly but energetic woman, was getting ready.Fr: Elle avait enfilé son manteau chaud et avait préparé une grande marmite de soupe aux légumes.En: She had put on her warm coat and prepared a large pot of vegetable soup.Fr: Aujourd'hui, elle avait une mission spéciale.En: Today, she had a special mission.Fr: Chaque année, le bureau de vote du village se transformait en clinique de vaccination contre la grippe.En: Every year, the village polling place transformed into a flu vaccination clinic.Fr: Un joli bâtiment en pierre blanche, avec des portes en bois massif qui laissaient entrer un peu du froid de l'hiver.En: A lovely white stone building with solid wooden doors that let a bit of the winter cold inside.Fr: Les infirmières s'affairaient à l'intérieur, leurs voix douces contrastant avec le vent glacial de l'extérieur.En: The nurses were busy inside, their gentle voices contrasting with the icy wind outside.Fr: Cependant, cette année-là, Élise avait remarqué quelque chose d'inquiétant.En: However, that year, Élise had noticed something worrying.Fr: Beaucoup de villageois hésitaient à venir se faire vacciner.En: Many villagers were hesitant to come and get vaccinated.Fr: Les rumeurs et la désinformation les rendaient nerveux.En: Rumors and misinformation were making them nervous.Fr: Élise, elle, connaissait l'importance de cette prévention.En: Élise, however, knew the importance of this prevention.Fr: Elle devait convaincre, surtout les plus âgés, de ne pas laisser la peur l'emporter.En: She needed to convince them, especially the older ones, not to let fear take over.Fr: Elle avait donc invité deux de ses voisins, Marc et Claudine, à l'accompagner.En: So, she had invited two of her neighbors, Marc and Claudine, to accompany her.Fr: Marc, un ancien pêcheur, toujours souriant mais un peu méfiant, et Claudine, une couturière, connue pour son esprit critique.En: Marc, a former fisherman, always smiling but a bit wary, and Claudine, a seamstress known for her critical mind.Fr: "Venez avec moi, et après, tout le monde boira une belle soupe bien chaude," leur avait-elle dit avec sa gentillesse habituelle.En: "Come with me, and afterward, everyone will have a nice hot soup," she told them with her usual kindness.Fr: Le chemin jusqu'au bureau de vote était difficile.En: The path to the polling place was difficult.Fr: La neige crissait sous leurs pieds, le vent s'engouffrait dans leurs écharpes.En: The snow crunched under their feet, the wind swept into their scarves.Fr: Mais Élise tenait bon, déterminée.En: But Élise held strong, determined.Fr: À leur arrivée, le silence du lieu les surprit.En: Upon arrival, the silence of the place surprised them.Fr: Peu de gens étaient là.En: Few people were there.Fr: Élise regarda Marc et Claudine, se demandant un instant si elle avait pris la bonne décision.En: Élise looked at Marc and Claudine, wondering for a moment if she had made the right decision.Fr: Mais elle n'abandonna pas son sourire.En: But she didn't let go of her smile.Fr: Ils franchirent ensemble les portes, accueillis par l'odeur de la soupe et la bienveillance des infirmières.En: Together, they passed through the doors, welcomed by the smell of the soup and the nurses' kindness.Fr: Peu à peu, les villageois curieux commencèrent à arriver.En: Gradually, curious villagers began to arrive.Fr: La chaleur humaine et l'arôme familier de la soupe réchauffaient les cœurs.En: The human warmth and the familiar aroma of the soup warmed the hearts.Fr: Élise ressentit la fierté d'avoir réussi à rassembler ses voisins, transformant le doute en solidarité.En: Élise felt proud to have succeeded in gathering her neighbors, transforming doubt into solidarity.Fr: Elle comprit alors la force de sa voix et de son engagement.En: She then understood the strength of her voice and her commitment.Fr: Ce jour-là, elle devint non seulement une grande dame respectée du village, mais aussi une défenseure déterminée de la santé de sa communauté.En: That day, she became not only a respected great lady of the village but also a determined defender of her community's health.Fr: L'hiver pouvait être rude, mais grâce à Élise, la solidarité était plus chaude qu'une soupe maison, et c'est sur cette note réconfortante que le village de Rozières vainquit la crainte.En: Winter could be harsh, but thanks to Élise, solidarity was warmer than homemade soup, and it was on this comforting note that the village of Rozières overcame the fear. Vocabulary Words:the village: le villagethe roof: le toitthe scarf: l'écharpethe nurse: l'infirmièrethe clinic: la cliniquethe rumor: la rumeurthe misinformation: la désinformationthe prevention: la préventionthe neighbor: le voisinthe fisherman: le pêcheurthe seamstress: la couturièrethe wind: le ventthe scarf: l'écharpethe decision: la décisionthe aroma: l'arômethe solidarity: la solidaritéthe community: la communautéthe fear: la craintethe lady: la damethe commitment: l'engagementthe heart: le cœurthe warmth: la chaleurthe pride: la fiertéthe stone: la pierrethe door: la portethe soup: la soupethe winter: l'hiverthe discomfort: l'inquiétudethe house: la maisonthe energy: l'énergie
Dans C'est Excellent, Judith Beller reçoit Babette de Rozières, fondatrice du Salon de la Gastronomie des Outre-Mer et de la Francophonie et Anne Le Nen, incarnation du capitaine Delandre dans 'Master Crimes'
Na Prvem programu Radia Slovenija 60 let oddaje praznujemo z 12 novimi pravljicami. Nocoj bomo premierno slišali pravljico Soda dežela avtorja Boruta Trpina. Izbrana je bila med 945 pravljicami, ki so prispele na natečaj za izvirno pravljico za oddajo Lahko noč, otroci! leta 2021. Tam, za petimi gorami, za enajstimi vodami, za sedmimi bregovi in trinajstimi žlebovi vsak v svojem ležalniku počivata zajec Milko in želva Rozi in po slamici srkata limonado … Pripoveduje: Željko Hrs. Avtor besedila: Borut Trpin. Avtor glasbe: Luka Hočevar. Mojster zvoka: Urban Gruden. Režiserka: Ana Krauthaker. Urednica oddaje Lahko noč, otroci!: Alja Verbole. Pravljica z natečaja za oddajo Lahko noč, otroci! 2021. Posneto v studiih Radia Slovenija 2025.
Bardo je ena od 32 občin, za katere veljajo določila zaščitnega zakona za Slovence v Italiji. Tam živeči rojaki pa se soočajo z velikimi težavami zaradi župana. Diskriminacija se dogaja iz dneva v dan, toda pritiskom ne bodo podlegli, pravi Igor Černo. Za svoje pravice se borijo tudi na avstrijskem Koroškem. Rozi Štiker in društvo Spunij se vztrajajo pri preoblikovanju spomenika brambovcem v Šentjakobu v Rožu in postavitvi parka miru v spomin na padle koroške Slovence. V Prezidu si ogledamo vzorčno turistično izobraževalno kmetijo. Zanima nas, kako bo s kadri, ki bodo delali na tej kmetiji. Z literatom, scenaristom in režiserjem Mikijem Rošem pa se pogovarjamo o obuditvi porabske gledališke družine Nindrik Indrik. Kaj pripravljajo? Prisluhnite!Foto (RTV SLO): Pravice manjšine so več kot vidna dvojezičnost
Kedy je ten správny čas na spoločné bývanie? A čo je ten najväčší dealbreaker pri spoločnom bývaní. Často bojujem s tým, že niekedy som matka. Keby sme mali upratovačku, naše hádky by neexistovali. A ako Denis nie je ochotný tolerovať chrápanie :) Pre extra obsah, šteklivé videá, nekresťanské rozhovory a iné špecialitky nás odberaj na našom HERO HERO! Chceš viac, než čo sa zmestí do epizód?
Beszélgetés Kocsis Rozi, bábszínházigazgatóval
Kako lepo je imeti prijatelje, ki so ob tebi takrat, ko jih potrebuješ. Pripoveduje: Asja Kahrimanović. Napisala: Iris Golob. Pravljica z natečaja za oddajo Lahko noč, otroci! 2021. Posneto v studiih Radia Slovenija 2022.
Candice Peyrac Rozières a une vingtaine d'années quand elle doit faire face au décès de son petit ami. Il goûte un plat qu'elle a cuisiné, fait une réaction allergique et meurt quelques heures après. Pendant dix ans, elle tentera de se reconstruire, naviguant entre le deuil et la culpabilité.A 30 ans, Candice Peyrac Rozières est maintenant maman. Dans cet épisode de Code Source, elle raconte son histoire au micro de Barbara Gouy.Écoutez Code source sur toutes les plates-formes audio : Apple Podcast (iPhone, iPad), Amazon Music, Podcast Addict ou Castbox, Deezer, Spotify.Crédits. Direction de la rédaction : Pierre Chausse - Rédacteur en chef : Jules Lavie - Reporter : Barbara Gouy - Production : Clara Grouzis et Orianne Gendreau - Réalisation et mixage : Julien Montcouquiol - Musiques : François Clos, Audio Network. Hébergé par Acast. Visitez acast.com/privacy pour plus d'informations.
Rozi, bersama temannya hendak berlibur ke beberapa kota. Namun saat diawal perjalanan banyak hal janggal yang dialami mereka, hingga bertemu disebuah kampung yang semua penduduknya itu fisiknya tidak wajar, dan setelah keluar dari kampung itu mereka mengalami banyak teror bahkan hingga narsumber ini bercerita teror itu masih ada.Bagaimana kisah selengkapnya?Simak video berikut, jangan lupa berikan like dan komentarnyaCopyright 2024, Lentera Malam
Send us a textEt si, malgré la douleur, malgré la culpabilité, nous étions capables ?Dans cet épisode bouleversant et lumineux de SHINE, j'ai le plaisir de recevoir Candice Peyrac Rozières, entrepreneure, maman, et autrice du livre Vous êtes capable (éditions Robert Laffont). Un récit authentique, sincère et profondément transformateur dans lequel elle partage son histoire marquée par l'abandon, le rejet, un deuil inimaginable, et surtout, une renaissance puissante.Ensemble, nous avons parlé de :La culpabilité et comment s'en libérerLe chemin de la résilience pour retrouver le gout de la vieLes outils concrets pour sortir du désespoirLa force d'oser être soi, enfinEt ce que veut vraiment dire : rayonner dans sa vie✨ Un échange vibrant, intime, porteur d'espoir. ✨ Une conversation entre deux femmes qui croient que transformer sa vie est non seulement possible… mais nécessaire.À écouter avec le cœur. ===================Comment soutenir ce podcast ? Le meilleur moyen de le faire est de vous abonner au podcast Shine! sur Apple Podcast, et d'y laisser votre avis en lui donnant 5 étoiles ! * Et bien sûr, n'hésitez pas à faire connaître Shine en le partageant à toutes les personnes qui vous sont chères et qui aspirent elles aussi à prendre le pouvoir sur leur vie et rayonner.=================== Aller plus loin ensemble ?Abonnez-vous à ma newsletter et recevez vos bonus exclusifs : https://www.christinelewicki.com/inscription/
Pénteki olvasóklub: 8 könyv, ami annyira izgalmas, hogy muszáj miatta egész éjszaka fennmaradni Joy 2025-03-21 19:01:00 Könyv Igazi könyvmolyként el sem tudnánk képzelni annál jobb érzést, mint amikor Annnnnnyira magába szippant minket egy regény, hogy nem tudjuk letenni, míg be nem fejeztük. Mozi és streaming: Itt a 8 legjobb, új film hétvégére Mafab 2025-03-21 18:12:02 Film Hétvége Mozi Mozi vagy inkább otthon néznél meg egy jó filmet? Segítünk a döntésben, sőt, még a választásban is! Megmutatjuk, szerintünk melyik a legjobb nyolc új film, amit ezen a hétvégén megnézhetsz. Elhunyt Balázs Éva színművész Librarius 2025-03-22 08:00:15 Színpad A Ceaușescu-diktatúra legsötétebb éveiben Balázs Éva előadóestjeivel a bátor és következetes kulturális ellenállást képviselte. A végére még jobban rákapcsoló Hunyadi akkor a legerősebb, mikor a hőse nincs a képernyőn 24.hu 2025-03-21 19:35:43 Film Az ambíciózus Hunyadi-sorozat jórészt beváltja a hozzá fűzött reményeket, Nándorfehérvárnál sem okoz csalódást. Évadkritika. Heti Klassz Grafitemberrel: Szülinapos Bach, zongoraest zsinagógában és cseresznyevirágok a fülnek Telex 2025-03-22 06:49:20 Zene Koncert Telex Zsinagóga Szellemi felüdülésre, idegi kikapcsolódásra vágyóknak néhány esemény, ahová szépen fel lehet öltözni – Grafitember heti szubjektív klasszikus zenei koncertajánlója a Telexen. Március 22-én történt kultura.hu 2025-03-22 00:01:00 Zene Koncert Cigányság 1986-ban ezen a napon tartotta meg bemutatkozó koncertjét a 100 Tagú Cigányzenekar a Budapest Kongresszusi Központban. Az 1985. november 2-án, eredetileg Budapest Cigányzenekar Országos Kulturális Egyesület néven megalakult, komolyzenei műveket, tradicionális magyar cigánymuzsikát, magyar nótákat és népdalokat játszó formáció az elmút évtizedek sor Minden idők tíz legborzalmasabb élőszereplős rajzfilmfeldolgozása Player 2025-03-21 17:30:20 Film Disney A Disney nem akar leállni a klasszikus rajzfilmjei élőszereplős remake-jeivel, ami egészen addig érthető piaci döntés, míg ezek a darabok rendre százmilliókat hoznak a kasszáknál. Erre csak Horváth Rozi halála után derült fény, a fűszerek magyar királynőjéről ezt nagyon kevesen tudták ContextUs 2025-03-22 04:02:10 Könyv Gyászol a magyar gasztronómia, mivel meghalt Horváth Rozi, aki egy klasszikus szakácskönyvet is az emberekre hagyott, ami rengeteg háztartásban megtalálható. Kovács Patrícia és Medveczky Balázs: Korkülönbség? Na bumm! Story 2025-03-22 08:00:01 Bulvár Párkapcsolat Kovács Patrícia Sajnos még mindig sokan felhúzzák a szemöldöküket, ha egy párkapcsolatban jelentősebb a korkülönbség a két fél között. Különösen, ha ez a nő javára írandó. Ezért is lehet jó példa a két színész két és fél éve tartó közös története, amelyről eddig keveset tudhattunk. Autizmussal diagnosztizálták Bella Ramsey-t. Origo 2025-03-21 21:34:51 Film Autizmus A spektrumzavaros állapotát 3 évig titkolta a színésznő. Autizmussal diagnosztizálták Bella Ramsey-t. Sós vízben főtt májas-tüdős, vascipellős halál és fojtogatás – A Hófehérke és a hét törpe eredettörténete elborultabb, mint hittük refresher.hu 2025-03-22 10:58:00 Film Mozi Disney A Hófehérke és a hét törpe című tündérmese az egyetemes kultúra szerves része. A héten debütált a mozikban az esti mesék nagyszínpados rocksztárjának előszereplős Disney-adaptációja, melynek apropóján fejest ugrunk a véres eredettörténet útvesztőjében. A további adásainkat keresd a podcast.hirstart.hu oldalunkon.
Pénteki olvasóklub: 8 könyv, ami annyira izgalmas, hogy muszáj miatta egész éjszaka fennmaradni Joy 2025-03-21 19:01:00 Könyv Igazi könyvmolyként el sem tudnánk képzelni annál jobb érzést, mint amikor Annnnnnyira magába szippant minket egy regény, hogy nem tudjuk letenni, míg be nem fejeztük. Mozi és streaming: Itt a 8 legjobb, új film hétvégére Mafab 2025-03-21 18:12:02 Film Hétvége Mozi Mozi vagy inkább otthon néznél meg egy jó filmet? Segítünk a döntésben, sőt, még a választásban is! Megmutatjuk, szerintünk melyik a legjobb nyolc új film, amit ezen a hétvégén megnézhetsz. Elhunyt Balázs Éva színművész Librarius 2025-03-22 08:00:15 Színpad A Ceaușescu-diktatúra legsötétebb éveiben Balázs Éva előadóestjeivel a bátor és következetes kulturális ellenállást képviselte. A végére még jobban rákapcsoló Hunyadi akkor a legerősebb, mikor a hőse nincs a képernyőn 24.hu 2025-03-21 19:35:43 Film Az ambíciózus Hunyadi-sorozat jórészt beváltja a hozzá fűzött reményeket, Nándorfehérvárnál sem okoz csalódást. Évadkritika. Heti Klassz Grafitemberrel: Szülinapos Bach, zongoraest zsinagógában és cseresznyevirágok a fülnek Telex 2025-03-22 06:49:20 Zene Koncert Telex Zsinagóga Szellemi felüdülésre, idegi kikapcsolódásra vágyóknak néhány esemény, ahová szépen fel lehet öltözni – Grafitember heti szubjektív klasszikus zenei koncertajánlója a Telexen. Március 22-én történt kultura.hu 2025-03-22 00:01:00 Zene Koncert Cigányság 1986-ban ezen a napon tartotta meg bemutatkozó koncertjét a 100 Tagú Cigányzenekar a Budapest Kongresszusi Központban. Az 1985. november 2-án, eredetileg Budapest Cigányzenekar Országos Kulturális Egyesület néven megalakult, komolyzenei műveket, tradicionális magyar cigánymuzsikát, magyar nótákat és népdalokat játszó formáció az elmút évtizedek sor Minden idők tíz legborzalmasabb élőszereplős rajzfilmfeldolgozása Player 2025-03-21 17:30:20 Film Disney A Disney nem akar leállni a klasszikus rajzfilmjei élőszereplős remake-jeivel, ami egészen addig érthető piaci döntés, míg ezek a darabok rendre százmilliókat hoznak a kasszáknál. Erre csak Horváth Rozi halála után derült fény, a fűszerek magyar királynőjéről ezt nagyon kevesen tudták ContextUs 2025-03-22 04:02:10 Könyv Gyászol a magyar gasztronómia, mivel meghalt Horváth Rozi, aki egy klasszikus szakácskönyvet is az emberekre hagyott, ami rengeteg háztartásban megtalálható. Kovács Patrícia és Medveczky Balázs: Korkülönbség? Na bumm! Story 2025-03-22 08:00:01 Bulvár Párkapcsolat Kovács Patrícia Sajnos még mindig sokan felhúzzák a szemöldöküket, ha egy párkapcsolatban jelentősebb a korkülönbség a két fél között. Különösen, ha ez a nő javára írandó. Ezért is lehet jó példa a két színész két és fél éve tartó közös története, amelyről eddig keveset tudhattunk. Autizmussal diagnosztizálták Bella Ramsey-t. Origo 2025-03-21 21:34:51 Film Autizmus A spektrumzavaros állapotát 3 évig titkolta a színésznő. Autizmussal diagnosztizálták Bella Ramsey-t. Sós vízben főtt májas-tüdős, vascipellős halál és fojtogatás – A Hófehérke és a hét törpe eredettörténete elborultabb, mint hittük refresher.hu 2025-03-22 10:58:00 Film Mozi Disney A Hófehérke és a hét törpe című tündérmese az egyetemes kultúra szerves része. A héten debütált a mozikban az esti mesék nagyszínpados rocksztárjának előszereplős Disney-adaptációja, melynek apropóján fejest ugrunk a véres eredettörténet útvesztőjében. A további adásainkat keresd a podcast.hirstart.hu oldalunkon.
Ajo që ndodh në shtëpinë e “Big Brother VIP”, padyshim që është më e ndjekura e më e komentuara në rrjetet sociale, si edhe në jetën e përditshme. Në lidhje me audiencën shumë të madhe të këtij spektakli ka mendime të ndryshme. Suksesi ka kaluar kufijtë e një spektakli në ekranin e televizorit e tani jemi përballë një fenomeni social që mund të quhet edhe si “Big Brother Mania”.
I am joined by Bill Barak to discuss why Rozi's so loved in the community, people who have gotten way too confident and why some dog keep getting stuck in the fence.
E ftuar në “Live From Tirana” ka qenë aktorja dhe regjisorja Rozi Kostani. Nisur nga rasti i reperit të njohur P.Diddy dhe akuzat ndaj tij që janë kthyer në qëndër të vëmendjes, a duhet ndarë arti nga artisti?
Send us a textThis week's episode is with Safiya Rozi. As a software developer degree apprentice and content creator, Safiya shares her approach to juggling a demanding workload through prioritisation and planning. She also discusses her experience as a degree apprentice and how she's navigated the corporate world, especially with her finances. This episode also touches on wardrobe building, where Sophia emphasizes the importance of quality over quantity. Learn how to build a sustainable wardrobe while managing finances, and get budgeting tips highlighting investing in skill-building, self-care, and celebrating achievements. FOLLOW SAFIYA:Instagram - www.instagram.com/safiyarozi/TikTok - https://www.tiktok.com/@safiyarozi?_t=8plrZy72dYe&_r=1Support the showFOLLOW PENNIES TO POUNDS
E ftuar në “S'e Kam me Ty” ishte aktorja Rozi Kostani, e cila tregoi vështirësitë në karrierën e saj, kujtoi hapat e parë në aktrim e shumë të tjera.
Nőnapi adás. ///////////////////////////////////////////////////////////////////////Órabeállítás, avagy az adás előtti bemelegítés. A Gong Bao (Kung Pao) csirke.A No, woman, no cry feliratozva.Annak örömére, hogy Tibivel végre facebook barátok lettünk, itt van két Pálfi György film is, a Nem vagyok a barátod, és a Nem leszek a barátod.Rosie a koncerten, és Rosiemarie Garcia a valóságban.Így énekel Olivia Newton John AC/DC-t.A képek és az adás, amik megörökítik a német megszállás szobrainak elkészültét.Az euronews összeállítása arról, hogy mit bontanak a Magyar Rádió épületei közül.A Lányok, fiúk előadás színlapja, és részlet a nyílt főpróbából.Orbán kalapban a szabadkai Zsinagóga megnyitóján.Áder hugi.Michael Jackson Thriller - indiai változat.///////////////////////////////////////////////////////////////////////Borítókép: Lovas RoziAdászene: AC/DC///////////////////////////////////////////////////////////////////////Support the showHa támogatnád a gombapresszót, akkor a Donably oldalunkon megteheted. Így tegyenek, akik nem szeretnének Barion tárcát regisztrálni hozzá: 1. Kattints erre: donably.com/gombapresszo 2. Regisztrálj vagy jelentkezz be a Donablyra. 3. Válaszd ki a neked megfelelő összeget (lapozható jobbra!). 4. Kattints a "fizetés barionnal" gombra. 5. Válassz, hogy bankkártyával, Google Pay-jel vagy Barionnal fizetsz. ////////A gombapresszó Twitter csatornája.Az élő adások helyszine, az MR4 csatorna. és itt egy kereső hozzá.Adászene listák: 2019 / 2020 / 2021 / 2022 / 2023Küldhetsz nekünk levelet is.
Zach LaVine, Bruce Brown, Malcolm Brogdon, Lonnie Walker, Royce O'Neale, Mikal Bridges, Dejounte Murray e tutti gli altri giocatori scambiati dalla nostra fantasia nella simulazione della trade deadline
La marmite a besoin de 3 pierres pour tenir sur le feu, il en est de même de la culture : il lui faut la musique, la langue et la cuisine pour vivre, infuser, survivre parfois. Enfant, la cuisinière Babette de Rozières ne parlait pas créole - c'était interdit- mais français, pourtant c'est bien créole que l'on mangeait à table. Les plats portaient en eux les histoires des siècles, des colonies, du sucre et de la canne, des épices, d'une terre et de ses fruits, de ses racines. Babette parle et cuisine créole, elle a même mis sur pied la plus grande case de métropole qui chaque année, fin janvier, vibre et fait entendre la culture des Outre-mer, c'est le salon de la gastronomie des Outre-mer, le Sagasdom.Les outre-mer, un monde au-delà des mers, trop souvent résumé en France métropolitaine à des températures sur une carte météo du journal télé. Entendez la voix de ces 12 territoires, celles des ancêtres, de la terre, de cultures, goûtez la richesse et les savoir-faire, l'attachement au potager, la voix qui a besoin d'une nuit de 48h de voyages pour aller des premiers rayons du soleil du matin à Nouméa en Nouvelle-Calédonie aux derniers à se fondre dans la mer à Wallis et Futuna.Avec Babette de Rozières, cuisinière, animatrice télé, auteure, icône de la gastronomie des outre-mer, Babette parle haut et franc, a créé en 2013 le Sagasdom, le salon de la gastronomie des Outre-mer, devenu rendez-vous incontournable de la fin janvier, porte de Versailles à Paris. De la gastronomie à l'endroit même où Victor Schœlcher a signé le traité d'abolition de l'esclavage, le 27 avril 1848, Babette donne des cours de cuisine créole les mercredi à l'hôtel de la Marine.« Enfant je n'avais pas le droit d'entrer en cuisine, c'était le territoire des adultes, mais comme je savais où ma grand-mère mettait ses plats, je trempais mon petit doigt dans la sauce, je goûtais et c'est comme ça que j'ai eu le goût des Antilles. »- La case de Babette à Maule - SAGASDOM à Paris les 26, 27 et 28 janvier 2024. L'écrivain Yann Queffelec est le président d'honneur de la 9ème édition, le chef d'honneur est Eric Briffard, Meilleur ouvrier de France.Quelques pistes pour aller plus loin : - Hop en cuisine avec Babette, éditions Orphie- Festins créoles, éditions Marabout- Goûts d'Antilles, recettes et rencontres de Jérôme Bertin et Aline Princet, éditions Mango- La cuisine créole a la côte sur les réseaux sociaux, les comptes se multiplient, de recettes en récits, notamment le compte de Jeremy Hortensia, alias Jeremys cooking, - Faites-nous découvrir les comptes que vous aimez : legoutdumonde@rfi.fr ou lgdm@rfi.fr- Carnaval des cuisinières à Pointe-à-Pitre à Guadeloupe chaque 15 août, depuis 107 ans. - Mémoire de l'esclavage.La musique : Gwendoline Absalon Kif Kif avec Pix'l. La recette
durée : 00:52:40 - Allô Macha - par : MACHA RIOND EPOUSE PREZELIN - Réécoutez un très grand moment d'émotion sur France Inter. Pour sa toute dernière émission, en 2006, Macha Béranger s'est entourée de Jean-Claude Brialy, de Christian Rauth, de Babette de Rozières, du médecin nutritionniste Jean-Michel Cohen et de l'humoriste Raphaël Mezrahi. - réalisé par : Marie-Hélène FAUQUET
Mari kita saksikan Wawancara Khas PRK Kemaman malam ini jam 8.00 mlm dalam segmen 'Kemamang untuk Kemamang' yang bertajuk "Peluang Kedua Untuk BN" di medium FB UMNO ONLINE dan Penerangan UMNO Bersama-sama dengan: Panel: Datuk Hj Rozi Bin Mamat Moderator: Salman Mohd Zaki #umnoonline #peneranganumno #kemamanguntukkemamang
Hailing from London's creative epicenter, Rozi Plain stitches a cosmic sonic quilt on “Painted The Room.” A member of This Is The Kit, Plain's fifth album Prize is a January sleeper to check out ASAP.
I go to Rozi's Wine House in Lakewood for the Jackie O's Brewery tap takeover. I sit down with the team to discuss business, their events...all while having a few drinks.
Part 2 of my visit to Rozi's Wine House for the Jackie O's Brewery tap takeover. More stories, more characters...and more drinks.
Miért nehéz a semmire gondolni, római vagy nápolyi vagy amerikai pizza, mi értelme van a hírlevélnek, ér-e családi társaságban telefonozni, illetve aszociális vagy antiszociális, mit csinál a berepülőpilóta, le kellene-e cserélni a Himnuszt, miért divat az irodalom nem ismerete, bosszant-e az éneklő kolléga, mi lett volna a világgal Lenin nélkül, miből doktorált Taylor Swift, hogyan készül a rizstészta, tud-e embert ölni a levegőbe lőtt és visszazuhanó puskagolyó, lassítva látnak-e a galambok, melyik Magyarország legsikerültebb épülete, folyamatos vagy pontszerű-e a boldogság, hibridekben ritkábban kell-e olajat cserélni, cserélik-e a hangstúdiókban a mikrofonszivacsot, létezett-e Horváth Rozi, mit isznak a jegesmedvék, könyvklub vagy edzőterem, honnan jönnek a puttók és miért nincs guggolva pisilő kövér kislányszobor, mi történik a szalagátvágás szalagjával, miért ciki sportközvetítést nézni rajongva? Zenék: Johnny B. Good by Kfir Ochaion; by Madura; by Piano Dreamland. --- Send in a voice message: https://podcasters.spotify.com/pod/show/csunyarosszmajom/message
Rozi Komlos from Sitshoothon Muay Thai has just returned to the ring after a 5 year hiatus which she took in order to prioritise her mental health. In this ep she speaks so thoughtfully and in such a real way about that time in her life. She gets into the nuts and bolts of how Muay Thai can support your health, her performance now the ring rust has well and truly gone and the epic goals she has for the balance of 2023.Join hosts Smokin' Joe Coverdale and Bridget Thakrar as they interview some of Australia's best Muay Thai fighters, trainers and promotors.Please rate, review and share on your socials. It helps us get into more ears and hopefully helps get you more fighting opponents. If you have a guest suggestion or any feedback please dm us on Instagram or email femalefightexperience@gmail.comYou can find us on Instagram here:The Female Fight ExperienceSmokin' JoeBridget Thakrar Join hosts Smokin' Joe Coverdale and Bridget Thakrar as they interview some of Australia's best Muay Thai fighters, trainers and promotors.You can find us on Instagram here:The Female Fight ExperienceSmokin' JoeBridget Thakrar
Bral halucinogénne drogy od 15 rokov. Vyskúšal všetko. NEXT? Budem to robiť postojačky! (ANDY KRAUS) https://open.spotify.com/episode/1IXsqXsEnwyUmWP5xJDSOL?si=THrC1YvVSk69wpTZN-OKZg alebo ŠĽAPKY V RIU A KEFOVAČKA V ISTANBULE https://open.spotify.com/episode/6TPcCubjQ759HyXZ9X5GO3?si=F4HkKjquQg6HD1WZ7vy3wg * Kúp si "kúsok" ZAPO - https://www.crowdberry.eu/opportunities/zapo * VRAŽEDNÉ PSYCHÉ a PROFIL ZLOČINU naživo! Pripravte sa na mrazivý krimi večer, 23. 6. o 19:00 / Piano Club, Trenčín. Lístky na http://www.zabavavpodcastoch.sk/zapo-tour Free-Cool-In production by ZAPO @zapoofficial
Jean-François Pilâtre de Rozier was one of two men who left the earth's surface and flew in Montgolfier's balloon for the very first time. He also designed a type of balloon that was given his name that flew using a combination of a lifting gas and hot air. More than 200 years later, his design would be used in the balloon that made the first non stop round the world flight. A Rozièr balloon Jean-François Pilâtre de Rozier in a Montgolfier balloon De Rozièr perishes in a baloon crash over Wimereux Don Cameron led the way in record breaking and unusual balloon design Double Eagle II Virgin Flyer The successful balloon circumnavigation by Piccard and Jones Images under Creative Commons licence with thanks to those Public Domain images available, NASA, the Smithsonian,The Virgin Group, Cameron balloons and Breitling.
Clive Anderson and Emma Freud are joined by Lisa McGrillis, Travis Alabanza, Joe Thomas and Emma Moran for an eclectic mix of conversation, music and comedy. With music from Rozi Plain and Jaz Delorean.
So yesterday, the Winchester born musician Rozi Plain – not singer songwriter, not folk singer FYI – released her new album, her seventh, the really very brilliant, Prize. Now out on the ever-excellent Memphis Industries, it is a thing of wonder. The night before it's release I had a chat with the record's creator about whether she reads reviews of her music, the impracticalities of pyro, elves, her work in This Is The Kit, her forthcoming tour, the mysteries of Wikipedia, how not to choose a stage name… all sorts of stupid shit. It was a hoot, it really, really was. Twitter - @jamesjammcmahon Substack - https://spoook.substack.com YouTube - www.youtube.com/channel/UC8Vf_1E1Sza2GUyFNn2zFMA Reddit - https://www.reddit.com/r/jamesmcmahonmusicpod/
2023 ist lanciert, zum zweiten Freitag des Jahres gibt es einiges zum anstreichen: Die schottischen Indie-Veteranen Belle & Sebastian bringen mit nur drei Tagen Vorlauf das 12. Album, Billy Nomates ist der moderne 80er-Traum, Rozi Plain und Margo Price lassen träumen und schwelgen. Press Play!
NPR Music's Hazel Cills and Marissa Lorusso join host Bob Boilen to share their favorite new tracks of the week, including the jagged sounds of Dublin's M(h)aol, former jazz prodigy and singer Kate Davis and more.Featured Artists and Songs:1. Decisive Pink: "Haffmilch Holiday" (Single)2. Artist: "Friendship Is Frequency," from Mind Palace Music3. Kate Davis: "Consequences," from Fish Bowl4. Fievel Is Glauque: "Days of Pleasure," from Flaming Swords5. Rozi Plain: "Help," from Prize6. M(h)aol: "THERAPY," from Attachment Styles
Tracklist :Kratwerk - Les Mannequins (Showroom Dummies)Acid Arab - Ya Malha ft. Wael AlkakRozi Plain - HelpAlek Lee - Different PlansRaffaellla Carrá - A Far L'amore Comincia TuNia Archives - So Tell MeJean Felzine - À blancOutkast - So Fresh, So CleanLee Alfred - Rockin' - Poppin Full Tilting Alan Hawkshaw - PlaymateMotorbass - EzioWoods - Moving To The LeftThundercat - A Fan's Mail (Tron Song Suite II)Benny Sings - The WorldA.G. Cook - BeautifulWhigfield - Think of YouWhigfield - Saturday NightLazy Flow, Shala & Pouvoir Magique - Arigatou4th Measure Men - 4 YouBrent Fayiaz - Gravity ft. Tyler, The Creator & DJ DahiBobby Womack - Nobody Wants You When You're Down And OutLos Incas - Le RapaceSimon & Garfunkel - The Boxer Hébergé par Acast. Visitez acast.com/privacy pour plus d'informations.
Shalom Bayis Part One: When to Reach out for Professional Help By: Mrs Rozi Wax LMFT --- Support this podcast: https://anchor.fm/mikvah/support
Head Keeper Alicia Sampson has been working with cheetahs for over a decade. Hear some of the stories from her time caring for cheetah cubs at the Cincinnati Zoo and get an update on Rozi and Daisy in this fun new episode!
Después de dos años, Billy Corgan vuelve al frente de Smashing Pumpkins para anunciar su nuevo disco, una ópera-rock que se publirará en 2023, que se dividirá en tres partes y que contendrá treinta y tres canciones, entre ellas, la contundente 'Beguiled'. Escuchamos a los neoyorkinos Been Stellar con uno de los mejores momentos de su EP homónimo, al genio Mura Masa con 'Hollaback Bitch ', junto a Shygirl y Channel Tres y a Rozi Plain con la preciosa 'Agreeing For Two', adelanto de su próximo álbum LITTLE DRAGON ft JID – Stay DYLAN - Girl Of YOur Dreams THUS LOVE – Family Man ZAHARA ft SHEGO – Merichane DELAPORTE - Desnudarnos Otra Vez VARRY BRAVA – La Ruta del Amor (ELYELLA & Innmir Remix) A CUCKHOLD' S REFRAIN - Peppermint Patty WILL SPECTOR Y LOS FATUS - Blackout TY SEGALL – Hello, Hi BEEN STELLAR - Manhattan Youth SMASHING PUMPKINS – Beguiled SECOND – Muévete y Siente ROZI PLAIN - Agreeing For Two MURA MASA ft SHYGIRL & CHANNEL TRES - Hollaback Bitch TAI VERDES – Two Sugar SUEDE – 15 Again THE BLACK ANGELS – Empires Falling Escuchar audio
The Cincinnati Zoo and Botanical Garden announced that the new cheetah cub, Rozi, will soon be introduced to her own puppy companion, Daisy, so the animals can be friends as Rozi grows. The Ohio zoo adopted Daisy from Animal Rescue Fund, Inc., where the puppy has five litter mates looking for forever families, the Cincinnati Zoo shared on Facebook. Daisy won't be the only puppy prowling the Cincinnati Zoo with a cheetah. Kris, another cheetah at the facility, has grown up with their dog companion, Remus, met in 2019. Kris and Remus still have sleepovers together most nights and play in the running yard. They don't play with the same kind of energy and enthusiasm as when they were youngsters, but they still enjoy each other's company. Typically female cheetahs will separate from their mothers and siblings at 2 years old, and Kris is two ½ now. Be sure to check the cheetah running yard to see if they are out and about!
Peta izmed 20 novih pravljic, izbranih med 945 besedili, ki so prispela na naš radijski natečaj za izvirno slovensko pravljico, je pravljica avtorice Iris Golob. V njej nas že nestrpno pričakuje majhna ljubezniva Žabica Rozi. » Ej Rozi, jaz te bom naučila plavati,« je mirno rekla štorklja in široko razprla krila, da dežne kaplje niso več močile žabice. Pripovedovalka: Asja Kahrimanović. Avtorica: Iris Golob. Režiserka: Ana Krauthaker. Oblikovalka zvoka: Sonja Strenar. Oblikovalec glasbe: Luka Hočevar. Pravljica z natečaja za oddajo Lahko noč, otroci! 2021. Posneto v studiu 02 Radia Slovenija, maj 2022.