Podcasts about so grateful

  • 89PODCASTS
  • 147EPISODES
  • 39mAVG DURATION
  • 1MONTHLY NEW EPISODE
  • May 5, 2026LATEST

POPULARITY

20192020202120222023202420252026


Best podcasts about so grateful

Latest podcast episodes about so grateful

The Pure Joy Project
UCM Fields of Faith 2026

The Pure Joy Project

Play Episode Listen Later May 5, 2026 39:40


Another night with the fine people of the University of Central Missouri! SO GRATEFUL! Jesus continues to glorify His Name and bless His people! #thePJP

The Modern Crone
The Modern Crone: Season 8: Resurrection with Juliet Stannard

The Modern Crone

Play Episode Listen Later Apr 19, 2026 72:43


Juliet Stannard is British and spent her childhood living in the UK, Germany, Hong Kong and Canada as her father was in the British Military. She started work and moved to Singapore in 1993 with her then-husband, via a short stint in HK.Juliet has worked in the Singapore Real Estate Industry for 26 years, and is now one of the Directors and owners of Citiprop – a very well-established agency on the island. Her life has been forged through a series of intense events and personal resurrections, which eventually led her on a journey of self-healing and exploring many types of therapy.Today, Juliet is in a strong and happy place, and it's a delight to welcome her to the podcast to share her story.Join us as Juliet shares:Her experiences of infidelity and betrayal, and the impact on her self-confidence and intuitionThe challenging dynamics of a family that keeps secretsThe warning signs of emotional manipulation, the small inner voice and gut feelingThe deeper importance of allowing ourselves to grieveThe varying degrees of betrayalThe intriguing world of private investigatorsHer horrendous experience of the Boxing Day Tsunami and her daughter's serious accidentHer incredible ability to find light in the darkest placesHow the body keeps the scoreDoes a series of ‘good luck' factors evidence the presence of guidance and protection?The slow and steady road to reclaiming her life, finding herself again and opening to joy and love through spirituality and presenceAnd if your spirit is stirred by these amazing conversations, don't forget to like, subscribe and leave a review - so more people can find their way to The Modern Crone. Thank you for tuning in!  So Grateful for the Modern Crone team -Theme music and season intro tracks:Sam Joole: www.samjoole.comCover design and photographyLuana Suciuhttps://www.instagram.com/luanasuciu/Luanasuciu@gmail.com Voice editing:Christopher Hales - Mask Music Studiosmaskmusicstudios@outlook.comStudio and Reel production:Kymberly Sngkymberlysngcm@gmail.com 

The Modern Crone
The Modern Crone: Season 8: Resurrection with Amy Kelly

The Modern Crone

Play Episode Listen Later Apr 4, 2026 37:00


Amy Kelly is a life coach, mentor, and host of the Dream Big With Amy podcast, supporting women in coming home to themselves after heartbreak, burnout, and big life transitions. Her work is rooted in nervous system safety, self-trust, and embodied power, helping women move from survival mode into grounded, self-led lives.Through her coaching and programs, Amy guides women to release old patterns in love, reconnect with their inner authority, and create relationships (with themselves and others) from wholeness rather than wounds. She believes heartbreak can be a powerful initiation, an invitation to rise, redefine love, and choose yourself fully.Join us as Amy shares:How her own heartbreak sent her on a soul adventure to find herself and her purposeHow alignment results in manifestationWhat is ‘heartbreak' and how does it disrupt our identityThe arc of heartbreak - emotion, anger, comparison, self-assessment, acceptance, release, then healingThe importance of self-regulation and her top techniquesHow a near-death experience was her wake-up callThe importance of listening to our intuitionRelationships and KarmaIntentionally building self-confidenceHow to trust in love again after betrayalThe peril of comfort and known patternsHeartbreak as an initiationYou can find Amy here:Website: https://www.amykellycoach.com/Instagram: https://www.instagram.com/amykellycoach_/LinkedIn: https://www.linkedin.com/in/amy-kelly-23a369b4/Podcast: Dream Big With Amy - https://podcasts.apple.com/gb/podcast/dream-big-with-amy/id1827926221And if your spirit is stirred by these amazing conversations, don't forget to like, subscribe and leave a review - so more people can find their way to The Modern Crone. Thank you for tuning in!   So Grateful for The Modern Crone team -Theme music and season intro tracks:Sam Joole: www.samjoole.comCover design and photographyLuana Suciuhttps://www.instagram.com/luanasuciu/Luanasuciu@gmail.com Voice editing:Christopher Hales - Mask Music Studiosmaskmusicstudios@outlook.comStudio and Reel production:Kymberly Sngkymberlysngcm@gmail.com

The Modern Crone
The Modern Crone: Season 8: Resurrection with Wachuka Gichohi

The Modern Crone

Play Episode Listen Later Mar 21, 2026 58:08


Wachuka, born and raised in Nairobi, Kenya, lives in a small mountain town, Nanyuki, where the slower rhythms of nature have become central to her personal healing and spiritual journey.Wachuka is the co-founder of Ikigai Nairobi, a nature and wellness-focused co-working company that creates inspiring spaces that reimagine work, community and wellbeing. After contracting Covid in 2020 and developing Long Covid and Myalgic Encephalomyelitis (M.E.) thereafter, Wachuka's life shifted in profound ways. Her health journey has opened a profound spiritual doorway; exploring her spiritual path with curiosity, and discovering her purpose through different healing modalities, spiritual arts and a connection to nature. She speaks with honesty about transformation, identity shifts, the courage it takes to rebuild a life from the inside out, and uses her journey to help others through the healing arts. Resources Instagram -https://www.instagram.com/healingshukie?igsh=MXF1Z2p3emZ6amt5&utm_source=qrMy Long Covid Storyhttps://www.facebook.com/share/1BytzrcMmg/?mibextid=wwXIfrLong Covid Support Grouphttps://www.facebook.com/share/g/1Dat8fMZPv/?mibextid=wwXIfrPatient Led Research Collaborative (a great organisation Wachuka supports led by patients leading the way in Long Covid research, awareness and advocacy. Great Long Covid resource) https://patientresearchcovid19.comM.E. Actionhttps://www.meaction.net/Ikigai - Nature and wellness-focused Coworkinghttps://ikigai.co.ke/ Join us as Wachuka shares:What is the global public health crisis of Long Covid? The huge range of symptoms that vastly decrease quality of life and, in some cases, are terminalThe issues with diagnosis and treatmentHer terrifying experience of contracting Long Covid and the connection with over-exertion and stressThe trauma and isolation of not being believedThe global online communities of Long Covid sufferersWachuka's exploration of alternative and functional approachesFollowing the intelligence of her body and spiritThe power of story and authentic voiceThe impact of the energy arts and nature in reconnection with the bodyHow her senses, dreams and intuition were magnified through illnessThe reframing, acceptance and healing that come through a spiritual journeyAnd if your spirit is stirred by these amazing conversations, don't forget to like, subscribe and leave a review - so more people can find their way to The Modern Crone. Thank you for tuning in! So Grateful for The Modern Crone team -Theme music and season intro tracks:Sam Joole: www.samjoole.comCover design and photographyLuana Suciuhttps://www.instagram.com/luanasuciu/Luanasuciu@gmail.com Voice editing:Christopher Hales - Mask Music Studiosmaskmusicstudios@outlook.comStudio and Reel production:Kymberly Sngkymberlysngcm@gmail.com 

Let's Be Cleere
The Cost of Always Being Connected

Let's Be Cleere

Play Episode Listen Later Mar 2, 2026 52:19


This conversation started not because I think social media or the internet is the enemy— that would be a little crazy considering you are reading this on an app and you most likely heard about it through social media. I am SO GRATEFUL for the gift of the online space, the community it provides, the resources it has illuminated, and the ability to connect with others in the most unique ways.However, I started to notice that I was literally scrolling at night and I could not even tell you what I saw. I was numbing out and I knew it, and yet I kept doing it.I noticed how tired my mind felt even when my body was still. How easily my attention scattered. How quickly I moved from one thing to the next without really being in any of it. Nothing dramatic. Just subtle. Quiet. Cumulative.Join "The Living Room" on Substack for more in depth notes on this episode! https://cleerelystated.substack.com

City Cast Pittsburgh
Will PA Ever Legalize Recreational Cannabis? Plus, ICE Updates and Crosby's Injury

City Cast Pittsburgh

Play Episode Listen Later Feb 20, 2026 46:54


Will this be the year Pennsylvania legalizes recreational cannabis? City Cast's Megan Harris and Sophia Lo are with contributor and TribLive reporter Colin Williams to talk about why the commonwealth is so far behind its neighbors and what local lawmakers can realistically do about it. There's good and bad news at the airport, more “snatch and grabs” by ICE, and new events for the NFL Draft. And we're sharing what we know so far about Sidney Crosby's injury at the Winter Olympics. Plus, Megan's SO GRATEFUL for everyone who's been in our DMs with more insights about recent shows. Thank you especially to everyone for your fish fry recommendations!  Notes and references from today's show: Are Republicans in Pa. ready for legal weed this year? Advocates are skeptical. [Spotlight PA] Pittsburgh City Council calls on Harrisburg to legalize marijuana [TribLive] After calling the police for help, a Brentwood man was arrested by ICE at court [Post-Gazette] Shapiro admin tells ICE to drop plans for Pa. detention centers, warns facilities may not get permits [Spotlight PA] Oakmont votes against immigration enforcement role, while Springdale officials say little [Public Source] Pittsburgh International opens five new dining options [Post-Gazette] ‘Alarming' levels of PFAS from Pittsburgh airport are being discharged into Montour Run watershed [The Allegheny Front] Cursive handwriting is set for a comeback in Pennsylvania schools [Pennsylvania Capital-Star] Jason Lando sworn in as Pittsburgh police chief [TribLive] Canada's Sidney Crosby suffers injury at Olympics, to get imaging [ESPN] Pitt Athletics to host block party complementing NFL Draft [TribLive] If you enjoyed today's interview with The Westmoreland's Director of Learning, Engagement & Partnerships, Erica Nuckles, learn more here. Learn more about the sponsors of this February 19th episode: Heinz History Center Living Memory Become a member of City Cast Pittsburgh at membership.citycast.fm. Want more Pittsburgh news?  Sign up for our daily morning newsletter. We're on Instagram @CityCastPgh. Text or leave us a voicemail at 412-212-8893. Interested in advertising with City Cast? Find more info here.

The Modern Crone
The Modern Crone: Season 8: Resurrection with Laila Malone

The Modern Crone

Play Episode Listen Later Jan 23, 2026 38:46


Laila Malone is currently in Grade 11 in high school. She was born in Dubai and moved to Singapore when she was very young, and has been living here for 14 years. When Laila was 8 years old, she was diagnosed with Leukemia – a huge experience for anyone, let alone an 8-year-old. She is now well and excited about finishing school and broadening her studies in the UK. Along the way, she has accumulated incredible practices and wisdom for resilience, healing and optimism. She is an inspiring young woman, destined for amazing things.Join us as Laila shares:her road to recovery, physically, mentally and spirituallythe importance of acceptance and non-judgementthe role of creativity and books in her healing journeyWhy ritual is so importantimportant guidance for families and young people on a cancer journeyAnd if your spirit is stirred by these amazing conversations, don't forget to like, subscribe and leave a review - so more people can find their way to The Modern Crone. Thank you for tuning in!   So Grateful for The Modern Crone team -Theme music and season intro tracks:Sam Joole: www.samjoole.comCover design and photographyLuana Suciuhttps://www.instagram.com/luanasuciu/Luanasuciu@gmail.com Voice editing:Christopher Hales - Mask Music Studiosmaskmusicstudios@outlook.comStudio and Reel production:Kymberly Sngkymberlysngcm@gmail.com 

Empower the stylist / Empoderar al estilista
Holiday Social Media marketing

Empower the stylist / Empoderar al estilista

Play Episode Listen Later Nov 21, 2025 9:42


You want to promote your business but it's holiday season and the kids are on school break

Tiny Trance Time Sleep Hypnosis with Professional Hypnotist Kimberly Ann O'Connor

#sleephypnosis #sleepaid #hypnosis #deepsleep #asmrsleep The session starts around 4:00I am SO GRATEFUL to OtterSpirit.com for sponsoring the beginning portion of this video and for gifting me these gorgeous bracelets. I have the Mystic Halloween Bundle (Leopard Skin/Orange Adventurine/Unakite) in size small with small stones.Use code: KIMBERLY20 for 20% off your purchase at otterspirit.comUse code: KIMBERLY30 for 30% off you order of over $99+_______________________________________________Visit consultinghypnosis.ca for info, consult and to shop pre-recorded sessions.*** Do you enjoy these sessions? Please make my day by leaving an honest Google Review here: https://g.page/r/CbzG8obmL1UmEBM/review (Thank you so much!) ***Well, hello everyone! I am delighted you are here. Join me on this hypnotic journey, as I will help you unlock a state of deep sleep where your body and spirit can rest and be rejuvenated.My name is Kimberly Ann O'Connor, a professional hypnotist living in Toronto and working with people who are struggling with their sleep. I guide people like you to step deeper and deeper into hypnosis and sleep, as I whisper softly and guide you.I want to thank you so much for your time and trust in listening to my sleep hypnosis videos. I wish you all the best for your most relaxing night and your rejuvenating sleep. Respectfully, KimberlyDo you want to go even deeper?✨ CHECK OUT MY WEBSITE! www.consultinghypnosis.co ✨ Is it time to journey into hypnosis together? Book your complimentary consultation at www.calendly.com/consultinghypnosis

The Good Glow
S18 Ep11: The Good Glow - Dominique Nugent: Messy Middle

The Good Glow

Play Episode Listen Later Aug 30, 2025 41:13


Dominique Nugent joins me Georgie, for an open captivating conversation about navigating the uncertainty of a fertility journey and all that comes with it. Dom today, shares with extraordinary honesty, an incredible sense of resilience and the kindness and compassion she is so loved for. SO GRATEFUL for her honesty. Join the September Reset Come to our Christmas Show Thank you Dove for supporting The Good Glow

dom dove messy middle nugent so grateful good glow
Feeling Good Podcast | TEAM-CBT - The New Mood Therapy
460: Ask David: The Fear of Happiness!

Feeling Good Podcast | TEAM-CBT - The New Mood Therapy

Play Episode Listen Later Aug 4, 2025 69:35


Ask David-- The Fear of Happiness! Although we had five questions for today's Ask David episode, we spend the entire podcast on the first question from a man with an intense fear of happiness. He wrote: How can I use exposure to overcome my fear of happiness? Hi David, How would you do exposure for the fear of happiness? Whenever I feel happy I immediately feel afraid because I had a very strict religious upbringing where many harmless forms of fun and enjoyment were completely forbidden. Even though I'm no longer a religious believer, the fear remains. Feeling good then makes me afraid, anxious and insomniac. This often goes on for days after something good happens and it almost seems as if I AM being punished after all! How can I recover when feeling good makes me feel so bad? Love your work and all that you do. Best regards, Tomas David's reply As I have said on numerous occasions, I do NOT recommend “methods” (like exposure) for “problems” (like your “fear of happiness.”) I think your problem is very treatable, but I work with patients systematically, and that doesn't mean starting out with a “method,” like exposure or any other method. I use a step by step approach, using T = Testing, E – Empathy, A = Assessment of Resistance, and M = Methods in a sequence. In addition, when I work with anxiety, I always incorporate these four approaches with every patient I work with: The Motivational Model: I bring Outcome and Process Resistance to conscious awareness and melt them away, if possible, using a variety of TEAM CBT approaches. The Cognitive Model: This involves a well-done Daily Mood Log to identify and challenge the distorted negative thoughts at one moment in time. The Exposure Model: Facing your fears, or testing them with an experiment. This is frightening, but required of every anxious patient. The Hidden Emotion Model: This is based on the idea that only “nice” people struggle with anxiety, with only a few exceptions, and that an unacknowledged problem is often hiding right behind the anxiety. The cure requires the Detective Step: identifying what the hidden emotion or feeling is. The Action Step: Expressing the suppressed feeling and or dealing with the problem you are avoiding. Your fear of happiness is an interesting problem for sure. One of my favorite movies, “Babette's Feast,” involves this theme. If you want some help, you could send me a partially completed Daily Mood Log. You will discover that you are the only one who is doing the punishing! It is that belittling, intimidating voice in your own head that is causing 100% of your suffering. I look forward to helping you challenge those voices! In the meantime, I'll add this to the latest Ask David podcast questions, in the hopes you might send the DML, and then Rhonda and I can comment in greater depth on the live program. Best, david Tomas kindly sent a Daily Mood Log, which you can see if you CLICK HERE As you can see, the Upsetting Event is simply “studying mathematics,” something he loves. However, he has the belief that if he allows himself to enjoy this or any activity, something terrible will happen to him. He traces this to a strict religious upbringing, and perhaps also to bullying he endured as a kid. You can see that this is intensely upsetting to him. If you look you will see that in 8 of the 9 categories of emotions on his Daily Mood Log (DML), he scores in the range of 80 to 100, which is intense and severe to extreme. The only emotion category that is not extremely elevated is the anger cluster, which he rated at only 40. You can see as well that his negative thoughts all involve the theme of punishment and destruction if he allows himself to feel happiness and enjoyment of life, or if he advances himself in life. In some of the emails he sent me, he traces this back to being bullied when young. . . possibly by kids who were jealous of his high IQ. As mentioned above, I don't throw methods (like exposure) at people based on a problem or diagnosis (in his case a phobia, the fear of happiness.) I also mentioned that I go through the T E A M model in a sequence, starting with Testing and Empathy, followed by the Assessment of Resistance and culminating in Methods. In addition, I always treat anxious patients with four powerful models, including the Motivational Model, the Cognitive Model, the Exposure Model, and the Hidden Emotion Model. I described these models above. The Motivational Model The Outcome Resistance has to do with the fact that Tomas may resist treatment because of his fear of the consequences of successfully achieving happiness. We will deal with that with Positive Reframing, including the Miracle Cure Question, the Magic Button, Positive Reframing, and the Magic Dial. In addition, we'll have to deal with Process Resistance. At some point, we will have to use exposure techniques, and we will want to find out if he's WILLING to do exposure even though it may be extremely anxiety provoking at first. We can dangle the carrot, letting him know that we anticipate a positive outcome, but also understand that facing his worst fears may be terrifying at first, and very uncomfortable. I will not try to persuade him to use any of the many versions of Exposure. He will have to persuade me that he's willing to do it. I suspect he will be, because he is asking for exposure, but if he says he wants to be treated without exposure, I will have to let him know I am not a good choice as a therapist for him! That's because I don't know how to defeat any form of anxiety without exposure. Of course, I cannot treat Tomas, or anyone, through an Ask David, but can only make teaching points. But I am teaching self-help techniques that have been helpful to many people. In an email, I asked him the Magic Button question, and he said he didn't think he'd push it. This indicates some understandable resistance that has to be dealt with. Positive Reframing is one way to deal with Outcome Resistance. The goal is not only deeper empathy but also helping patients “see” that the negative thoughts and feelings they are struggling so desperately to overcome are actually positive in many ways. Once they “see” this, it is kind of a pleasant shock to the system, and their resistance to change typically disappears. Then we ask them to set goals for each negative feelings—a lower level of each feeling that would allow them to feel better and not lose all the wonderful positives we have discovered. That's why it's better NOT to push the Magic Button. To help Tomas or anyone see and list the positives in their negative thoughts and feelings, we ask two key questions about each one: What are some possible advantages, or benefits, of this negative thought or feeling? How might it help me? What does this negative thought or feeling show about me and my core values as a human being that's positive and awesome? Typically, this leads to list of 10 to 20 positives that have three characteristics. To give you an example, his intense loneliness is an expression of his love for people and the great value he sees in meaningful relationships. And his anxiety serves to protect him from danger, and is therefore an expression of self-love. And his feelings of inferiority—in spite of his tremendous intelligence—show humility, which is not only a spiritual quality, but also can make a person of great intelligence more accessible, more vulnerable, and more attractive. Inferiority may also be an expression of his honesty and willingness to acknowledge his shortcomings, as well as his accountability. We could easily go on and on, and it might be a great exercise for you to try find the positives in several other of his negative thoughts and feelings by asking those two questions. Once my patient and I have listed 10 or more positives, I ask if these positives are True and valid? Powerful? Important? Nearly always, I get a resounding YES to each question. Then I use the Magic Dial to see what they might want to dial each negative feeling down to in the % Goal column of the Daily Mood Log. Is this Positive Reframing process straightforward? Easy? Not really. I make it look easy, because when I teach I want people to understand, but “seeing” these positives is, in reality, incredibly challenging for most people. In fact, You can see the Positive Reframing that Tomas completed on his own if you CLICK HERE As you can see Tomas almost completely missed the boat when he tried to identify the positives in his negative thoughts and feelings. I mention this because it is a CRUCIAL step in TEAM CBT, and people often have a tremendously hard time “seeing” the positives in their negative thoughts and feelings. A big part of the reason is that society teaches us the opposite. In fact, negative feelings are Labeled as a bewildering array of more than 200 so-called “mental disorders” by the American Psychiatric Association in their “bible,” the DSM (Diagnostic and Statistical Manual of Mental Disorders.) But here's something even MORE surprising. Rhonda—a highly respected and admired TEAM CBT therapist and teacher—also struggles to find the positives during today's podcast. Once someone has pointed them out, you can suddenly “see” them. But on your own, you may have a lot of trouble at first with Positive Reframing, which is anything but simple, but extraordinarily powerful once you “get it.” I recently told my weekly Tuesday psychotherapy training group at Stanford that TEAM CBT is extraordinarily difficult to learn and master—nearly always requiring years of study and practice—and perhaps the most challenging form of psychotherapy ever developed. She was angry and told me I'd have to do large controlled outcome studies to validate that claim! Yikes! I may be wrong, and there could be other more difficult forms of therapy, but I still believe what I'm saying because I see it every single day. Many of the most powerful and helpful concepts, such as the four “Great Deaths” of the “self” for the therapist and for the patient in TEAM, and the Acceptance Paradox, and more are hard to learn! But worth it, IF you take the time to learn this method. And if you wish to use TEAM CBT, on yourself (for self-help) or with your patients (if you're a therapist) you will have much greater success after you master this powerful but elusive skill. The Cognitive Model After Rhonda and I worked with Positive Reframing, we went on to the technique that usually starts the M = Methods section, called “Explain the Distortions.” This powerful method includes answering three questions about one or several of the distortions you can find in one of the thoughts you want to work on first. First, select the thought and identify all the distortions in it, listing them by abbreviations in the Distortion column on your Daily Mood Log. For example, if it is an example of All-or-Nothing you can put AON in that column. And you can put OG for Overgeneralization, and so forth. Often, you will find five or even ten distortions in a single negative thought. Let's say you work on, “If I'm happy, I'll be destroyed.” This alarming thought includes AON; LAB, FT, DP, and ER. And it's also a Hidden SS. Choose the distortion you want to work on first. Let's say it's Fortune Telling (FT). Why is this distortion, FT, considered a thinking error in general? Why does the FT distortion your specific thought pretty much make the thought unreasonable? In other words, Why does the FT in your thought NOT map onto reality? And finally, why is the FT is this thought unfair? As an exercise, turn off the podcast for a moment and write down your answers to those three questions. Once you're done, you can check the answers at the end of the show notes. It's a great skill to practice and learn, because it will usually make it really easy for you to generate positive thoughts that satisfy the necessary and sufficient conditions for emotional change. Do you know what they are? Write them down before you look at the answers at the end of the show notes. Just take a guess, but WRITE SOMETHING DOWN before you look! But DON'T look until you've written down your own answers! Hey, did you peek, or did you write down the answers first? I get it! And I forgive you! However, you missed out on a great opportunity for learning if you skipped the written exercise. Or, to put it positively, I try to make the exercises fun and interesting. And if you do them, you'll learn some cool and helpful things rapidly. It's like riding a bicycle. You've got to get on and ride to learn how to do it! But here's what's really interesting. You'll notice that Rhonda, once again, really struggles with this exercise during the podcast. Although I think of Explain the Distortions as a really easy TEAM CBT method, experience with real people has over and over again provided abundant evidence that it's NOT easy for many, or possibly most, people at first. So, what's the point? Here's the point. If you're a therapist, this method is powerful, and will richly reward you for the time and effort you spend in learning how to do it! But you cannot take it for granted if you want to use it in an actual therapy session. And if you are simply looking for self-help, the exact same thing is true: the method is incredibly helpful and well worth some time and effort to “get it!” In addition, to challenging the obviously distorted thoughts on his Daily Mood Log, what other methods might be helpful to Tomas? The Exposure Model Well, there are a great many, including the Exposure techniques he was asking for. For example, he could intentionally make himself happy, and then fantasize some horrible punishment using Cognitive Flooding. The idea would be to make himself as anxious as possible for as long as possible, until he finally gets bored with the fantasy, which will definitely happen eventually, and the anxiety disappears. Exposure is terrifying at first, and it is supposed to be. That's whey and how it works! The Hidden Emotion Model There are many helpful variations on the Exposure front, and the Hidden Emotion Model might also be key. Is there some problem or issue in his life that Tomas is not dealing with? The Class on this technique in the (now entirely free for the summer of 2025 app) Feeling Great app has many details and exercises and examples to show how this mind-blowing technique works. That's it for today's podcast. I want to thank you, Tomas, for providing us with a fascinating problem, and all of you who send in your questions. We are SO GRATEFUL that you are bouncing back, Rhonda, after your ordeal with radiation therapy for your lymphoma, and send you all our love and best wishes for joyful and complete healing and liberation from your nightmare! Warmly, Rhonda and David Answers Here is my answer to first exercise on the necessary and sufficient conditions for emotional change from a positive thought. . The necessary condition for emotional change: The Positive Thought must be 100% correct. The sufficient condition for emotional change: The Positive Thought must reduce your belief in the disturbing negative thought. Sometimes you'll want to reduce it all the way to zero. Sometimes, that's not necessary, especially with Should Statements. Here are my answers to the three questions about Explain the Distortions above. In general, FT is a thinking error when you are making arbitrary alarming predictions without strong evidence that supports those predictions. In particular, there is no evidence that supports the claim that people who feel happy rapidly become the victims of some horrific disaster or punishment. This thought is very unrealistic because the ONLY punishment that Tomas has experienced is the result of his own negative thoughts! This thought is unfair because it puts Tomas in handcuffs so he will be unable to enjoy his life.

The Superlatively Yes Podcast
The Gratitude Episode

The Superlatively Yes Podcast

Play Episode Listen Later Apr 27, 2025 52:33


Hello listeners! Jen and I explore gratitude, personal growth, and simplifying life in this episode. We share our reflections on what we are grateful for, from small daily joys to deeper connections with family and friends. The conversation also delves into practical tips for streamlining tasks and simplifying life, emphasizing the value of mindfulness and intentional living. This conversation explores various strategies for simplifying life, managing household responsibilities, and expressing gratitude. We also discuss practical tips for meal preparation, household management, and the benefits of gratitude on mental and physical health. The dialogue emphasizes the power of positive thinking and the impact of gratitude on overall well-being. Again, thank you so much for listening, and in case we haven't told you lately, we are SO GRATEFUL for you!   Superlatively Yes website Superlatively Yes on Patreon Superlatively Yes Instagram Page Superlatively Yes Facebook Page Tanya's Instagram reframeyourworld on Insta

Strong By Design Podcast
Ep 386 What Does the Bible Say About Gratitude? Thanksgiving Day Special

Strong By Design Podcast

Play Episode Listen Later Nov 27, 2024 44:20


Good food, good meat, good God, let's eat!God is good, God is great, put that turkey on my plate!!Rub-A-Dub-Dub, Thanks for the Grub!Who doesn't love a good ole Thanksgiving Day blessing!?It is a wonderful time of year to spend time with loved ones and to gather around the table to eat our favorite holiday meal.Thanksgiving Day is a special day for us to connect with friends and family members we do not see throughout the year. It is also the most traveled day of the holiday season which has its own frustrations and drawbacks.Today on Strong By Design, hosts Jared Haley and Chris Wilson recall their favorite Thanksgiving Day foods, most cherished Thanksgiving memories and what it means to live in gratitude, what matters most and to be truly thankful for our many blessings.Happy Thanksgiving everyone, we are SO GRATEFUL for you!  "We might not have everything that we think we want, but in reality, we actually do have everything." — Jared Haley  Time Stamps00:30 - Welcome to the Strong By Design podcast 00:54 - Join Hosts Chris Wilson and Jared Haley for today's exciting special episode 02:28 - Discover the Thanksgiving table essentials you simply can't miss 09:35 - The Thanksgiving favorite that Chris and Jared avoid! 15:23 - The most memorable highlights of Thanksgiving 21:00 - Thanksgiving: What's the first thing that comes to mind? 24:46 - Why practicing gratitude changes everything 28:18 - Rewards vs. Responsibility: Are you avoiding the hard part? 31:15 - The power of praising Jesus in times of suffering 34:20 - How to live your life to the fullest 40:46 - Chris' challenge to listeners this Thanksgiving 42:37 - Please share, and leave ratings & reviews for the SBD podcastSupport the showConnect w/ CriticalBench: Youtube Facebook Instagram CriticalBench.com StrongByDesignPodcast.com

The Lethal List
E239: born with power

The Lethal List

Play Episode Listen Later Nov 3, 2024 90:00


TRACKLIST: 1. Some Of Us Are Brave - Danielle Ponder 2. I'm So Grateful - orãclë 3. Miracles - SAULT 4. born with power - duendita 5. Gimme All Your Love - Alabama Shakes 6. Ain't It a Sin (feat. The Bullets) - Charles Bradley 7. MASHUP - JEMS!, Elujay, J.Robb & Chase Shakur 8. Our Way - Tkay Maidza 9. Gimme Love (Channel Tres Remix) - Joji & Channel Tres 10. DYKWYD - Butcher Brown 11. Cycles (feat. Hiatus Kaiyote) - Shafiq Husayn 12. The OG's (Organic People) - Marquis Hill 13. Softly - Clairo 14. Fall Into You - Rosehardt 15. Toronto - Snoh Aalegra 16. That's What I Love - Leon Bridges 17. Can I Call You Rose? (Cover) - SOLOMON 18. Dream Girl - Ravyn Lenae & Ty Dolla $ign 19. Think Of Me - AbrahamBlue 20. Turn Back - Sam Wills 21. Nont For Sale - Sudan Archives 22. Lullaby (feat. Soft Glas) - CHARGAUX 23. Somewhere (feat. Fishdoll) - Soft Glas 24. DEEP BLUE - EARTHGANG, Spillage Village & Little Dragon

Mystic Dog Mama
Honoring Our Animals + Ourselves: Normalizing Pet Loss Grief with Beth Bigler

Mystic Dog Mama

Play Episode Listen Later Sep 14, 2024 81:10


In this week's episode, I chat with Beth Bigler of Honoring Our Animals. Beth is a pet loss grief counsellor who is offering a really important and valuable space for us to explore the various kinds of grief we will inevitably experience in our lives, especially when we invite our four-legged beloveds into our lives. Beth and I have one of the most important conversations I think I've had around the topic of grief, of our culture's complete avoidance of the grieving and mourning experiences, and how we can transform with and through the process of honouring our animals, and honouring ourselves.This is not a sad conversation, don't worry. But, it is a validating one. We talk about all different kinds of grief - whether that's the grief we feel around not having the kind of dog we thought we would have, or the grief of feeling we are not a good enough pet parent, as well as the grief of anticipating our pet's passing, and the grief we feel when they have crossed over. Beth shares so many helpful tips, and she speaks from personal experience because it was her own experience of seeing a pet loss grief counsellor when her beloved cat Arnie was passing from cancer that catapulted her into this work. Beth also shares how her relationship with Arnie has continued to grow and deepen even as he is on the other side.Whether you are currently experiencing grief, whether you did in the past and didn't feel supported, whether you're wanting to know how to support another who is in the grieving and mourning processes, or whether you just want to know more ways to deepen your relationship with your pet in life and on the other side, this is such an impactful episode. And I hope that it helps create the space here in this community to honor, recognise, and hold space for us all as we experience the big emotions we have in our lives. You can connect with Beth on her website https://honoringouranimals.com⁠ and Instagram ⁠https://instagram.com/honoringouranimals⁠ If you are enjoying the podcast, I would be SO GRATEFUL if you would consider subscribing and leaving a review on Apple podcast. I wish Spotify had that option, but only Apple does at the moment. Reviews are so helpful for me to know what you are enjoying so that I can make sure to create content you find helpful, and reviews also really help others to find the podcast and find the support they are looking for in this beautiful, beautiful community we are creating together! You guys are just so amazing, and I am so grateful for each and every one of you!⁠ https://mysticdogmama.com⁠Instagram: ⁠https://instagram.com/mysticdogmama⁠

Loving Later Life
ENCORE OF EPISODE 73: MY DAUGHTER RACHEL WRIGHT, MONOGAMOUS/POLYAMOROUS PSYCHOTHERAPIST

Loving Later Life

Play Episode Listen Later Aug 26, 2024 69:35


Encore encore Rachel Wright! This episode is hugely important to me as Rachel's mom. I am still getting messages as to how it has helped others by giving them an understanding about other lifestyle choices… “I was SO GRATEFUL to be able to step into a conversation (on this topic) with some knowledge provided so candidly and thoroughly by you and Rachel!“ My daughter Rachel MA, LMFT  is a distinguished psychotherapist and is non-monogamous/polyamorous... and she and her partners Yair and Ashley just had a beautiful baby boy.  In this episode, we talk about how to have tough conversations and improve communication in all of your relationships. The 2nd half is about her non-monogamous/polyamorous life, its challenges, misconceptions and much more. Someone recently said to me that they listened to the first part of the episode but stopped listening to the rest about non-monogamy because it's not how this person chooses to live. While this lifestyle isn't for everyone it is so important to learn about it. Why? In our current divisive climate we all know that when there is ignorance, there is judging and othering, which can lead to bullying, violence, loss of rights, freedoms and isolation. We need more understanding, kindness and love in this world and it starts with getting to know each other better. I hope you'll listen to this episode at least once and share it to help open more minds and hearts and hopefully encourage understanding and acceptance for all kinds of love.

Byte Sized Blessings
S17 Ep198: 198: Karl Beckstrand ~ Encountering Miracles In Unlikely Places

Byte Sized Blessings

Play Episode Listen Later Aug 21, 2024 41:49


Please do note that this episode comes with a TRIGGER WARNING for discussions of childhood sexual abuse. It is with pleasure that I introduce everyone to my guest this week, Karl Beckstrand! Karl is a wonderfully complex human (like all of us) and we had a great discussion around ancestral stories, the stories we tell ourselves, and how stories shape this world. But it was his miracle story this week that got me ~ how, after a life shaped by his addiction to sex, Karl suddenly found the healing and the answers that he was looking for! (and guess what everyone...it was in the place that he least expected it!) And I think that a lot of things are like this in this life-that we are eternally looking for answers...or any sort of help around the issues that we are muddling through, and sometimes, those answers are in places that we are not ready to go to yet! But always, they are always there, waiting for us! To check out Karl's groovy work and his books, click here. I am ever SO GRATEFUL to all of you who listen to this podcast, and support me with sweet reviews and glorious texts telling me how much you love the pod! You'll never know how much those words mean to me. Your bit of beauty this week comes from an astonishing video shot off of Australia! (I admit it, I am a little late to the party as this happened 9 months ago!) A whale was giving birth and sharks were gathering...suddenly, from EVERYWHERE, dolphins appeared, and helped defend the calf and mother from the sharks! It is truly a jaw-dropping sight to see! Watch it here!

Byte Sized Blessings
S17 Ep198: 198: The Byte: Karl Beckstrand ~ Encountering Miracles In Unlikely Places

Byte Sized Blessings

Play Episode Listen Later Aug 21, 2024 7:48


Please do note that this episode comes with a TRIGGER WARNING for discussions of childhood sexual abuse. It is with pleasure that I introduce everyone to my guest this week, Karl Beckstrand! Karl is a wonderfully complex human (like all of us) and we had a great discussion around ancestral stories, the stories we tell ourselves, and how stories shape this world. But it was his miracle story this week that got me ~ how, after a life shaped by his addiction to sex, Karl suddenly found the healing and the answers that he was looking for! (and guess what everyone...it was in the place that he least expected it!) And I think that a lot of things are like this in this life-that we are eternally looking for answers...or any sort of help around the issues that we are muddling through, and sometimes, those answers are in places that we are not ready to go to yet! But always, they are always there, waiting for us! To check out Karl's groovy work and his books, click here. I am ever SO GRATEFUL to all of you who listen to this podcast, and support me with sweet reviews and glorious texts telling me how much you love the pod! You'll never know how much those words mean to me. Your bit of beauty this week comes from an astonishing video shot off of Australia! (I admit it, I am a little late to the party as this happened 9 months ago!) A whale was giving birth and sharks were gathering...suddenly, from EVERYWHERE, dolphins appeared, and helped defend the calf and mother from the sharks! It is truly a jaw-dropping sight to see! Watch it here!

The Backup Plan
44: Breast Biopsy

The Backup Plan

Play Episode Listen Later Aug 7, 2024 15:51


Sharing my stereotactic breast biopsy in chair experience at Hoag Hospital Newport Beach.In the middle of IVF treatment, I felt something a little strange in my left breast and decided to get it checked out before my frozen embryo implantation. I'm SO GRATEFUL that my doctor at Kindbody get my set up with the Hoag team so quickly.Also talking about mental health and maintaining support expectations during a health crisis.00:00 Introduction00:56 The Biopsy09:02 Aftercare & Emotional Breakdowns13:22 Next StepsRELATED VIDEOS:My cancer scare in the middle of IVF. https://youtu.be/9DOScCIxkF8Support the Show.---Hey, I'm Meredith! I'm becoming a single mother by choice using a known donor; I'm so stoked to be having a baby with my gay best friend. After a few tries with the turkey baster in 2023, I turned to IVF in Spring of 2024.Watch video versions of The Backup Plan on YouTube!CONNECT WITH THE BACKUP PLANWebsite: https://backupplanpod.comInstagram: https://instagram.com/backupplanpodTikTok: https://www.tiktok.com/@backupplanpodFacebook: https://www.facebook.com/backupplanpod CONNECT WITH MEREDITHInstagram: https://instagram.com/meredithk8 WORK WITH THE BACKUP PLANVisit https://backupplanpod.com/work-with-me for brand partnerships and business inquiries.Created, produced and hosted by Meredith Kate, co-produced by Julian Hagins.Visit https://backupplanpod.com for show notes, transcripts, partner links, and our newsletter.

Matt O'Grady Coaching Podcast
Quick Gratitude Exercise: Our Senses

Matt O'Grady Coaching Podcast

Play Episode Listen Later Apr 23, 2024 11:10


I was talking with a few of my coaching clients this week about how quick and easy it is to feel good when we practice thankfulness and appreciation on a regular basis. we often take our Senses for granted but not today! :) Listen in for a a great exercise that will make you feel great immediately! (And if you want to hear me cry tears of joy and get choked up!)I am SO Grateful to you for listening. THANK YOU.Love, Matt.mattogradycoaching.com#Senses#Presence#Waking Up#Present Moment#Awareness#Gratitude#Gratefu#Thankful# Thank You#Appreciation# LOA

You Can Call Me
Episode 01: QUICK HIT: The "Bossy" Wound

You Can Call Me

Play Episode Listen Later Feb 20, 2024 21:06


You Can Call Me Bossy Podcast EP 001: QUICK HIT: The Bossy Wound WELCOME! I'm so excited to introduce to you the first official episode of the YOU CAN CALL ME "BOSSY" PODCAST! In this episode, we dive into a personal journey of mine, as I navigate and move through my own "bossy wound" in real time. This episode is a vulnerable reflection of my own personal experiences with the "bossy wound" and I share how I acknowledges and deal with my own natural questions and the challenges that come with it. From setting boundaries to seeking support, my journey is a raw and honest exploration of growth and self-awareness. Join me as we unravel the complexities of the "bossy wound" together and discover actionable takeaways that you can hopefully implement into your own life! Key Takeaways: What is the "Bossy Wound" and why does it matter? Exploration of the shadow self and shame associated with certain traits Learn about Navigating Boundaries and Integrity Emphasizing the importance of not letting the bossy wound hold back personal and professional growth Key Timestamps [1:00] – Suppressing shadow self impacts life and purpose. [7:23] – Seeking independence by embracing triggering feedback positively. [13:01] – Raising awareness and being accountable. [17:12] – Embracing and working through societal criticisms positively. If you enjoyed this episode and are excited for more, please be sure to SUBSCRIBE as Quick Hit Episodes will be dropped every Tuesday at 5am ET!Don't forget to write a review - I would be SO GRATEFUL! - 5 stars would be incredible ;) LET'S FREAKING GO! CONNECT WITH ME: Follow me on Instagram, LinkedIn, TikTok, or join my STAND IN YOUR POWER FACEBOOK GROUP Grab a signed copy of my bestselling book STAND IN YOUR POWER HEREWatch my TEDx Talk “The Wisdom of Your Ancestors Should Be Ignored” HERE

ADHD As Females
NEW Evidence: ADHD & The Menstrual Cycle with Dr Nighat Arif

ADHD As Females

Play Episode Listen Later Jan 16, 2024 39:34


How's that break from the podcast working out? C'mon it's been over 2 whole weeks! :) In any case, on discovering new evidence that High & Low Estrogen Exacerbate ADHD Symptoms I HAD TO share it! As ever, I'm NOT an expert, just a late diagnosed ADHDer..but I'll tell you who is:THE LEGENDARY Dr Nighat Arif! BBC Breakfast & ITV This Morning's Resident Dr returns to explore what Multiple Hormone Sensitivity Theory means, to give us all some invaluable advice,& to invite us to join her Women's Health Collective. SO GRATEFUL for her support of this podcast and all of her incredible work for Women's Health!If you've not heard Dr Nighat's original ADHDAF Interview LISTEN HERE. Giving credit where credit's due to ADHD Women's Wellbeing Podcast for sharing this information with me on social media so that those in need in our community can benefit. Please help get this crucial conversation out there and support marginalised communities by sharing this episode far and wide! By hitting those stars and writing a review/commenting you help this information reach more listeners in need. If you are a creator, credit those who inspire your own work so that their work is visible to and can help those in need in your own network.TOGETHER we can make change happen! TW:Mentions of FGM, PMDD, Relationship Struggles, Suicidal Ideation, Risky Behaviour, Depression, Cancer, If you are struggling, you are not alone. please REACH OUTIf you've found this podcast helpful & are able, please help me continue to help others by joining our Community for Peer Support OR leave  a tipMASSIVE THANKS TO ALL PATRONS!Gold Tier Patrons Shoutout: RachSlatts Leanne S Clare Wilson Michie Kim Pierpoint Amy Davies Ceci Mary Suzanne Tanser Katy Smtih Jacqueline McGeachie Jennifer Wilson Jo Rachel Stewart Christie Katie Enstone Ani Kemsley Lizee Oliver Michelle Bellyou  Olivia Dyer Gurjit Thandi Jody Tracy Wilkes Ruth Lester Kimi Wright Rachel Williams Sahra Lou Kirsty Jackie Allen Lou O'Connell Carly Taylor JenM Claire Protherough Reece English Louise MacDonald Claire Dowling Ally Rathbone Daina Stinnett Rosie Gee  Dr Explodo PhD Lindsay Knox Ally Mac Cat Marshall Siobhan Campbell Kara Romana Broughton Anna Byrom Nikkie Wilson Kirsty Witkowska Abbie Whitelaw Rhianne Caitlin Lewis Gillypompom Andie MacInnes Donnie Jackie Whittingham Vanessa Fisher Marianne Kelly Lyndsey Lowdon Claire Robinson Charlotte Lynskey Matilda Wanless Abi Wood Tabitha Buck Fanny Willy Paula Gleeson Kirsten Richardson Louise Kilgannon-Patel Kirsti B Gemma Beauchamp Jenni Bell Jaime Kerns Sarah Spurgeon Sara Jill Toni Morgan Ian Hepworth Louise Townend Amy Holliday Dawn Farmer HTMLQueen (Bonnie) Jill Saunders Milly Withers Meg Jennie King Elaine Koczubik Victoria Galbraith Abi Holland Elizabeth Wilson Vickie Hill Vicky Parker Clare Hunter Annabel Isabelle Paquette Fern Keeley BEE Kate Smith Carley Fischer Gemma Schneide & Rachael Morrice who helped make this episode possible; raising ADHD awareness and providing validation & information to those who desperately need it.Jingle originally by Dawn remixed by Sessionz Support the show

The Bar is Ankle High
E67: Conspiracy Trains

The Bar is Ankle High

Play Episode Listen Later Nov 23, 2023 76:21


This week Jami Fregeau - The Neurodivergent Nurse - takes the lead on researching and tells Katie about how Paul "Buster" Murdaugh - accused murderer who himself was murdered by his own father - had ADHD. We discuss the darker sides and signs of ADHD in teens and young adults including the downfalls of substance abuse, emotional dysregulation, and how white privilege can actually handicap you more than ADHD ever could. It's the last week before Garet comes back from maternity leave and we are SO GRATEFUL that Jami made time for us in her supremely busy schedule to cover this topic for us. Would you like to hear more about ADHD and criminal activities/propensities? If so - tell us on social media on Instagram @thebarisanklehigh.    If you want to support us - the best way to do that is to leave us a 5-star and/or written review everywhere you can find our podcast! If you have a few dollars to spare - you can support us by joining our Patreon at www.patreon.com/thebarisanklehigh - right now ALL patrons get access to ad-free episodes and bonus episodes!

REDEEM Her Time
BONUS | My UN-Black Friday FREE GIFT for YOU...a WITH-God Life Vision Guide

REDEEM Her Time

Play Episode Listen Later Nov 17, 2023 3:19


Hey friend- I've got a FREE GIFT for you…but first I have a question…What will YOU be doing 1 WEEK from TODAY? Instead of spending TIME (& MONEY) in-line or on-line on things that won't last (cuz I bet you can hardly remember how you spent it just a year ago)…why not invest TIME (for FREE) creating a WITH-God Vision for 2024 and beyond.What is HE calling YOU to in 2024 in your…FAITH-WALKFAMILYFRIENDSHIPSSERVICE/WORKSTEWARDSHIPWELLNESSPASSIONSDWELLINGEnvision a LIFE + BIZ that will glorify HIM in this season…and in light of ETERNITY.Here's my UN-BLACK FRIDAY DEAL (actually it's a FREE GIFT…cuz I'm SO GRATEFUL for YOU) Click here to join the REDEEM Her Time Community and access my brand-new WITH-God LIFE VISION GUIDE (usually reserved only for clients inside my program) Inside you'll get:Guide + Worksheets with questions + playlist for the 8 Areas of AttentionGuided Coaching Video to focus on working through the vision processFree Coaching & Feedback on your questions & implementation insideImagine going into the NEW YEAR with a VISION of where you're going WITH-God……that way you don't WASTE MORE TIME just hoping things will happen.Click the here to claim your FREE GIFT inside the REDEEM Her Time Community before you get into all your preparations …and I'll be waiting inside. L.Y.L.A.S. (Love Ya Like A Sis)LissaP.S. Take your next best step and schedule a BUSYNESS BREAKTHROUGH CALL …discover the key to REDEEMING Your TimeVisit the REDEEM Her Time Website https://redeemhertime.com> Grab the free FILL YOUR CUP FIRST Guide> Join the free REDEEM Her Time Community> Submit a question or comment…or leave a review>>> or DO ALL-THE-ABOVE!

REDEEM Her Time
BONUS | My UN-Black Friday FREE GIFT for YOU...a WITH-God Life Vision Guide

REDEEM Her Time

Play Episode Listen Later Nov 17, 2023 3:19


Hey friend- I've got a FREE GIFT for you…but first I have a question…What will YOU be doing 1 WEEK from TODAY? Instead of spending TIME (& MONEY) in-line or on-line on things that won't last (cuz I bet you can hardly remember how you spent it just a year ago)…why not invest TIME (for FREE) creating a WITH-God Vision for 2024 and beyond.What is HE calling YOU to in 2024 in your…FAITH-WALKFAMILYFRIENDSHIPSSERVICE/WORKSTEWARDSHIPWELLNESSPASSIONSDWELLINGEnvision a LIFE + BIZ that will glorify HIM in this season…and in light of ETERNITY.Here's my UN-BLACK FRIDAY DEAL (actually it's a FREE GIFT…cuz I'm SO GRATEFUL for YOU) Click here to join the REDEEM Her Time Community and access my brand-new WITH-God LIFE VISION GUIDE (usually reserved only for clients inside my program) Inside you'll get:Guide + Worksheets with questions + playlist for the 8 Areas of AttentionGuided Coaching Video to focus on working through the vision processFree Coaching & Feedback on your questions & implementation insideImagine going into the NEW YEAR with a VISION of where you're going WITH-God……that way you don't WASTE MORE TIME just hoping things will happen.Click the here to claim your FREE GIFT inside the REDEEM Her Time Community before you get into all your preparations …and I'll be waiting inside. L.Y.L.A.S. (Love Ya Like A Sis)LissaP.S. Take your next best step and schedule a BUSYNESS BREAKTHROUGH CALL …discover the key to REDEEMING Your TimeVisit the REDEEM Her Time Website https://redeemhertime.com> Grab the free FILL YOUR CUP FIRST Guide> Join the free REDEEM Her Time Community> Submit a question or comment…or leave a review>>> or DO ALL-THE-ABOVE!

ADHD As Females
S2.Ep4:Rach Idowu - ADHD,Intersectionality,Work & Communication

ADHD As Females

Play Episode Listen Later Sep 19, 2023 66:19


SO  excited to be joined by Rach Idowu for this very special episode!Featured in NY Times,BBC,Stylist & more;late diagnosed ADHD LEGEND works tirelessly to raise ADHD Awareness with her informative content.She created ADHD Flashcards to help identify the symptoms.Rach gave us so many pearls in this blether!Including:ADHD and Intersectionality-People from working class backgrounds and ethnic minorities are left out of a lot of the conversation and research on ADHD. Impacts can be even more detrimental to those who may not have the financial support and support from people in society.Communicating needs to friends and family - how to explain ADHD to people in their lives.Navigating ADHD in the workplace including how to self-advocate for yourself.We are SO GRATEFUL to this legendary lady and know you will LOVE this episode as much as we do! THANK YOU SO MUCH RACH!If you are struggling with any of the topics covered, you are not alone.There is help out there so please reach out!Tickets are selling fast for the ADHDAF LIVE UK SHOWS IN DECEMBER! Uniting the ADHDAF Community at what can be a triggering time. Get your Tickets HEREIf you've found this podcast helpful & are able, please help us continue to help others by joining our Community for Peer To Peer Support and MORE OR leave us a tipMASSIVE THANKS TO ALL OUR PATRONS!Gold Tier Patrons shoutout: RachSlatts,Rachael Riley,Derec Thompson,Leanne S,Laura Fleming,Clare Wilson,Michie,Kim Pierpoint,Amy Davies,Ceci,Kelsey F,Katherine Wilkinson,Alarna Pigmatiello,Elle, Mary N,Suzanne Tanso,Katy Smith,Jacqueline McGeachie,Lynne McKenna McNally,Linda Collins,Jennifer Wilson,Jo,Rachel Stewart,Christie,Claire Turner,Katie Enstone,Ani Kemsley,Lizzee Oliver,Nicola Mackenzie-Cracknell,Michelle Bellyou,Olivia Dyer,Gurjit Thandi,Ailish,Jody Ellen,Charlotte Holtom,Heesoo Lee,Nyki McKenzie,Ruth Lester,Kimi Wright,Rachel Williams,Sahra Zekiri,Lorna Lou,Chelsie Louise,Kirsty Cassell,Jacki Allen,Helen McEwan,Nic Hewett,Carly Taylor,Jen M,Claire Protherough,Reece English,Cara Aurora,Laura,Louise MacDonald,Claire Dowling,Ally Rathbone,Jenny Jimenez,Trudy,Daina Stinnett,Rosie Gee,Dr Explodo,Kayak Lady,Lindsay Knox,Gill Blackall,Ally Mac,Kat Marshall,Siobhan Campbell,Kara,Lynsey Hoskins,Anna Byron,Ali Velo,Nikki Wilson,Kirsty Witkowska,Catherine Hickey,Michelle A,Abbie Whitelaw,Rhianne,Sofia Buccheri,Natalie,Caitlin Lewis,GIlly Pompom,Andie MacInnes,Niki,Donnie,Kim Michelle,Jackie Whittingham,Victoria Closs,Vanessa Fisher,Marianne Kelly,Jade Badge,Emma Pearce,Lyndsey Lowdon,Nelly Griggs,Claire Robinson,Tallis Morris,Charlotte Lynskey,Magdalena Kuna,JosieJoJo,Georgie Chisholm,Rachel Jones,Matilda Wanless,Alicia,Abi Wood,Tabitha Buck,Sarah Coldrey,Erika AE,Natasha Sines,Fanny Willy,Kirsten Richardson,Louise Kilgannon-Patel,Kirsti,Collette Morrison, Carol Falkner, Sally,Gemma Beauchamp, Jessica Williams, Disa SIF,Jenni Bell, Paula C Gleason & Nella Scurfield who helped make this episode possible; raising ADHD awareness and providing validation & information to those who desperately need it. JOIN USTW: Contains swearing, ableism, racism, classism, sexism, ADHD denying, depression, anxiety Support the show

Creator. Created. Creating.

I watched a show recently that reminded me of something I had completely forgotten about that I am SO GRATEFUL this show brought back to my attention, and that is... how my stubborn insistence to "have it my way" SAVED MY LIFE. Literally.

I Wasn't Always Like This
A Weekend Full of Maddie

I Wasn't Always Like This

Play Episode Listen Later Jul 22, 2023 18:30


Although she often checks in with me, I had to share about this recent weekend I had that was simply full of Maddie! From a dream to the return of a piece of furniture to an engraved brick, Maddie reminded me of a truth that I always hold on to: That I am never alone. So Grateful for that.

so grateful
Abundant Vibes and Affirmations
Check In/ Announcements

Abundant Vibes and Affirmations

Play Episode Listen Later Jun 12, 2023 0:49


Hey friends! It's been awhile since I checked in with you, so how are you? How have you been doing? I just wanted to make a couple short announcements. First, I wanted to ask for a small favor! If you could take a second and leave my podcast a rating and a review on whatever platform you listen on, I would be SO GRATEFUL!  Second, I wanted to remind you about the Q&A feature on Spotify! Feel free to not only answer the questions, but also use that as a way to let me know if you have any ideas on new episodes! I would LOVE your input and feedback! Coming up pretty soon I'm gonna be experimenting with some different types of episodes, maybe introduce some guided meditations? What do you think?  Anyway, thank you SO MUCH for being a loyal listener, I truly love you, and hope you have an amazing day!!  Learn more about your ad choices. Visit megaphone.fm/adchoices

love spotify so grateful
Dents And Dreams a Paintless Dent Repair Podcast
5 Year Anniversary Celebration | Dents & Dreams 63

Dents And Dreams a Paintless Dent Repair Podcast

Play Episode Listen Later Apr 29, 2023 184:46


So Grateful for all of the support and help I've had along the way. Huge Thanks to everyone. Too Many Guests to list...

You Need Therapy
Friendship Philosophies with Laura Tremaine

You Need Therapy

Play Episode Listen Later Mar 27, 2023 67:05


This week Kat dives into **friendship** with Laura Tremaine. Laura is an OG blogger turned author who's latest book, the Life Council, is coming out on April 4th... and trust us, you want to get your hands on this book. Her book describes the 10 kinds of friends that every human needs and gives an in depth look at what Laura has learned about friendship though both the ups and downs of her own.  In this episode, Laura and Kat talk about Laura's "Friendship Philosophies" that have helped ground and protect the friendships she currently has in her life. Listen to the full episode to find out what philosophy made Kat have to puttee book down, take a break, and do some serious self reflection. Laura is full of both wisdom and light hearted fun conversation and we are SO GRATEFUL to now call her a friend of You Need Therapy!!! Follow Laura: @Laura.tremaine Order The Life Council Follow Kat on Instagram: @Kat.Defatta Follow the podcast Instagram: @YouNeedTherapyPodcast Have a question, concern, guest idea, something else? Reach Kat at: Kathryn@youneedtherapyodcast.com Heard about Three Cords Therapy but don't know what it is? Click here!   Produced by: @HoustonTilleySee omnystudio.com/listener for privacy information.

Why Struggle? Podcast w Barbara J. Faison
Week 6 - Pat Yourself On the Back

Why Struggle? Podcast w Barbara J. Faison

Play Episode Listen Later Feb 6, 2023 4:39


My mother and father were both very kind, loving and wise people. Yes, I recognize what a gift I had with both of them and as I got older, and I was sure to let them know how much I appreciated them. My mother, Annie Lorene Jackson, was an elementary school teacher from a Pelham, GA, population of about 3500 now, I imagine it was smaller when she lived there. She was the first person in her family to attend college. She graduated Albany State College/University in1957 and married my father, Moses Cornelius Faison who was working as a librarian in Albany. I have had a love affair with words since the womb I suspect. lol. As you can see, education was a cornerstone in my life and continues to be foundational to who I am as a person. My mother became will in 2011 and she lived with me from 2012 - 2015. I got married in 2014, for the first and only time. :) While my mother lived with me/us for those three years she would encourage me to pat myself on the back...A LOT. Even as a young child I tended to be very serious and focused. Getting married and having my mom and her dog, Lacee, move in with us was a very different lifestyle from it being just me as a single person. I still hear her voice saying, "Baby, pat yourself on the back." Those words make me smile. So I'm patting myself on the back today for being consistent with my journaling and sending out this newsletter/audio post/podcast. It's 37 days into 2023 and I have journaled daily. Yes! In the energy of my mother...what can you do to pat yourself on the back?... I'd love to hear from you. You can send your self-encouraging "pat on the back" to me at barbarafaisonllc@gmail.com. I'm also really excited about my upcoming Affirm Your Life - 14 day audio program on the power of using affirming words in your life. I wonder where I got that from. lol I've been keeping the people in my community busy with listening and testing the affirmation tracks. I am SO GRATEFUL all of my community members. If having early access to my offerings or testing out my tracks sound like something you'd enjoy, consider checking out my Encouraging PIP membership, it's only $9/month. If you are regularly joining our Wednesday night LIVE sessions the Dedicated PIP membership is only $26/month and it would be a cost savings - you are automatically registered and sent the links for our monthly lives. Patreon is an online portal where I share more of my personal musings, behind the scenes, and practices, it is a paid membership community, you can find out more here. The card pulled a card for us from my card deck -Relax, Listen, and Trust Your Inner Guidance. #2 - TRUST- I am able to CREATE the life I Desire to LIVE. Let me know if this card resonated with you as well, barbarafaisonllc@gmail.com.https://linktr.ee/barbarafaison --- Send in a voice message: https://anchor.fm/barbara-faison/message Support this podcast: https://anchor.fm/barbara-faison/support

How Not To Suck At Divorce
49. Divorcing and Still Living with Your Ex

How Not To Suck At Divorce

Play Episode Listen Later Jan 19, 2023 45:05


You're getting divorced, which sucks. But now, you still have to temporarily live under the same roof as your EX!!!?? WTF.   We know, we get it. On this episode of How Not to Suck at Divorce, we are going to tackle the subject of what you can do to preserve your sanity while still living in the same house with your soon to be ex spouse.    Questions like: Can I date other people before I get divorced? Can I spend money on myself and going out if I'm still living with my ex? How will my ex and I figure out kid time? How do I make sure my ex and I are splitting household chores evenly? Will all be answered!   We are nearing the end of season 3 of our show and we are SO GRATEFUL for all of our listeners. We know that you have a lot going on in your life right now and we are honored that you carve out some time to spend with us.    We know that divorce is hard. We know it's long and draining.  We are here to help guide you, offer you information, entertainment, and empathy and ultimately, help you not SUCK at getting divorced.  Please rate and reivew our show!! And message us on social, we would love to hear from you!!

Memorize What Matters
Questioning God (moment of meditation on Psalm 13)

Memorize What Matters

Play Episode Listen Later Nov 29, 2022 6:56 Transcription Available


Is it ok to question God? Is it blasphemous to be desperate and frustrated with Him? Taking a closer look at Psalm 13 - and many other psalms in the Bible - it's clear that David was not a stranger to questions, fear and frustration. But what can we learn from this example? Listen to the Psalm 13 Song: https://www.youtube.com/watch?v=85-8S4n98AM   Dive in Deeper! This short devotional was first published in the Bible Memory Community, a gorup of 500+ people from around the world who gather online to encourage and inspire each other to hide God's Word in their heart. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join You are also welcome to send any comments and feedback via our contact page: https://www.biblememorygoal.com/contact

Memorize What Matters
Dangers of the "Comfort Gospel"

Memorize What Matters

Play Episode Listen Later Nov 22, 2022 8:04 Transcription Available


Most of us tend to live our lives in a way that prioritizes comfort and avoids struggle. This is natural, but it's not how Scripture instructs us to live. These are the passages of Scripture most people don't memorize, because they're much harder to understand and live out.

Memorize What Matters
Don't Ignore This Critical Bible Memory Review Method (5 tips)

Memorize What Matters

Play Episode Listen Later Nov 18, 2022 10:15 Transcription Available


Oral review - the process of speaking what you've memorized out loud - is a critical part of retaining Scripture. Without it, you'll likely never have the confidence to use your Bible memory in daily conversation. Here are 5 practical methods you can start using to review orally. Resources Mentioned in this Episode: Bible Memory App (get 20% using this link): https://biblememorygoal.com/promo/memorygoal/ Bible memory community: https://www.biblememorygoal.com/join/ Jam Looper app (iPhone): https://apps.apple.com/us/app/jam-looper/id1061465697 If you'd like, you can watch the contents of this episode on YouTube to see how each of these methods works: Watch on YouTube

REDEEM Her Time
Got your Gratitude on Girl? You're Invited to a free 7-day GRATEFUL ANTICIPATION CHALLENGE

REDEEM Her Time

Play Episode Listen Later Nov 16, 2022 5:27


Hey girl- when you see this pop up in your library more than once in the same week...you know it's something good! Today it's to THANK YOU for being a listener, whether you've been faithful since the beginning or just stumbled across the most recent episode. I am SO GRATEFUL you are here.And with GRATITUDE in my heart, I have... 1 ASK...that you leave a review (and hold me accountable to reviewing the podcasts I've been binging lately)1 GIFT...a special invite to join the REDEEM Her Time Community for our 7 day GRATEFUL ANTICIPATION CHALLENGE...and get 7 days FREE! We kick off Sunday, Nov 20th, so don't put it off...But you gotta use this link https://lissafiggins.com/join-7And if you wanna go deeper and take Redeeming your Time to the next level in your life, schedule a free 15 min Schedule-Shaping Strategy Session and let's chat. Book yours at lissfiggins.com/simplify I always love hearing from you, so I invite you to connect with me @lissafiggins on any social platform or by email at lissa@lissafiggins.com

REDEEM Her Time
Got your Gratitude on Girl? You're Invited to a free 7-day GRATEFUL ANTICIPATION CHALLENGE

REDEEM Her Time

Play Episode Listen Later Nov 16, 2022 5:27


Hey girl- when you see this pop up in your library more than once in the same week...you know it's something good! Today it's to THANK YOU for being a listener, whether you've been faithful since the beginning or just stumbled across the most recent episode. I am SO GRATEFUL you are here.And with GRATITUDE in my heart, I have... 1 ASK...that you leave a review (and hold me accountable to reviewing the podcasts I've been binging lately)1 GIFT...a special invite to join the REDEEM Her Time Community for our 7 day GRATEFUL ANTICIPATION CHALLENGE...and get 7 days FREE! We kick off Sunday, Nov 20th, so don't put it off...But you gotta use this link https://lissafiggins.com/join-7And if you wanna go deeper and take Redeeming your Time to the next level in your life, schedule a free 15 min Schedule-Shaping Strategy Session and let's chat. Book yours at lissfiggins.com/simplify I always love hearing from you, so I invite you to connect with me @lissafiggins on any social platform or by email at lissa@lissafiggins.com

Memorize What Matters
A Challenge to be "Overflowing" (Col 2:6-7)

Memorize What Matters

Play Episode Listen Later Nov 15, 2022 5:47 Transcription Available


Join Josh as we meditate on Psalm 103 and Colossians 2, especially entering into the holiday season, and what it means when Paul tells us not just to be "rooted and built up" in Christ, but also to be "overflowing with thankfulness?" The questions you can ask yourself this week include: What are you grateful for? What is giving you energy and joy? What are you the most proud of this year with work or family? Join the 7-Day Bible Memory Challenge! Within our Bible memory community, we're in the middle of a 7-day challenge where we set a stretch goal to memorize a passage of Scripture. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join/ 

Memorize What Matters
"Small" vs "Weak" vs "Little" (there's a difference in God's eyes)

Memorize What Matters

Play Episode Listen Later Nov 1, 2022 4:58 Transcription Available


When Jesus speaks of faith in the Gospels, he often uses the words "small" and "weak" and "little" as descriptors. Although technically synonyms, there's a slight difference in meaning that makes a big difference in how we may view ourselves. Listen as Josh encourages you to allow God to magnify the small things in your life to make them impactful to those around you. Dive in Deeper! This short devotional was first published in the Bible Memory Community, a gorup of 500+ people from around the world who gather online to encourage and inspire each other to hide God's Word in their heart. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join You are also welcome to send any comments and feedback via our contact page: https://www.biblememorygoal.com/contact

Memorize What Matters
7 Bible Memory Mistakes I've Made (& how you can avoid them)

Memorize What Matters

Play Episode Listen Later Oct 28, 2022 Transcription Available


The downside of sharing my Bible memory journey publicly on this podcast and the YouTube channel is that you also get to see all my failures and mistakes. Here are 7 of the biggest mistakes I've made so far and some thoughts on how you can avoid doing the same thing I did. Would you rather watch this on YouTube? Check it out here: YouTube: https://www.youtube.com/watch?v=No8P3h09W2s  Resources Mentioned in this Episode: An Approach to Extended Memorization of Scripture: https://twojourneys.org/all-books/an-approach-to-extended-memorization-of-scripture/?ref=%3D  His Word in My Heart: https://geni.us/his-word-janet-pope  The Major System PDF Guide: https://www.biblememorygoal.com/resources/number-memory-pdf/ 

Memorize What Matters
How Many "Talents" Has God Given You? (Matthew 25)

Memorize What Matters

Play Episode Listen Later Oct 18, 2022 6:51


In this week's moment of meditation, let's take a closer look at the parable of the talents. If you put yourself in this story, are you the servant who received 1, 2, or 5 talents? Take a moment to reflect on the blessings you've been given, be grateful for them, and then allow the gravity of what God expects from you sink in. Dive in Deeper! This short devotional was first published in the Bible Memory Community, a gorup of 500+ people from around the world who gather online to encourage and inspire each other to hide God's Word in their heart. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join You are also welcome to send any comments and feedback via our contact page: https://www.biblememorygoal.com/contact

Memorize What Matters
Are You "Seasoned with Salt"? (moment of meditation)

Memorize What Matters

Play Episode Listen Later Oct 4, 2022 5:01


What does Paul mean in Colossians 4 when he tells the reader to be "always full of grace, seasoned with salt"? In this week's short devotional, Josh takes a closer look at how the Bible uses salt as a metaphor and how we can apply that (and the Scripture we memorize) to our daily interactions and conversations. Dive in Deeper! This short devotional was first published in the Bible Memory Community, a gorup of 500+ people from around the world who gather online to encourage and inspire each other to hide God's Word in their heart. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join You are also welcome to send any comments and feedback via our contact page: https://www.biblememorygoal.com/contact

Memorize What Matters
How Long Would it Take to Memorize the ENTIRE Bible?

Memorize What Matters

Play Episode Listen Later Sep 30, 2022 17:57


Have you ever wondered if it's possible for any human to memorize the entire Bible, word-for-word? If so, how long would it take...and has anybody done it? Listen as Josh shares his own experience and does some simple math to show what IS reasonable. It's important to note: there's value in memorizing even single verses of the Bible - you don't have to go all in on an entire book or testament! And if you need some extra help or inspiration to get started, you can follow our START HERE page or get helpful tips on YouTube: Start Here for Bible Memory: https://www.biblememorygoal.com/start/  Follow on YouTube: https://www.youtube.com/c/biblememorygoal?sub_confirmation=1

Girl, Let’s Be Real
[PEP TALK] Why Not You?

Girl, Let’s Be Real

Play Episode Listen Later Sep 28, 2022 12:05


Episode #50, Let's Gooo!! I am SO GRATEFUL for you! Thank you from the bottom of my heart for being here and being along on this journey with me. We are JUST GETTING STARTED!In today's PEP TALK, we're talking about, "Why Not You?" We talk about how to REFRAME your thoughts when looking at where someone else is in life, who they are, or what they have. Instead of thinking things like, "I wish I was like her" or "I wish I had that" or "She's so lucky," I share with you ways to reframe your thoughts by asking yourself questions that will actually SERVE YOU. We talk about the MINDSET you need to MAKE IT HAPPEN - to be the person you want to be, to live the life you desire to live, and to have those things you so badly want for yourself and your family. Can't wait to hear what you think!*GIFT  just for YOU! Totally FREE!!*I am sharing my Girl Boss Morning Routine Workbook that I use in my coaching with you totally FREE because so many people have seen RESULTS once they've put it into ACTION! And I want the same FOR YOU girlfriend!!>>DOWNLOAD FOR FREE NOW!I would love to WORK TOGETHER! http://www.jennaklopfenstein.comIf you haven't already, come say hi and connect with me on Instagram! ------> @jenna.klopfenstein

Memorize What Matters
Where Do Verse and Chapter Numbers Come From in the Bible? (the backstory)

Memorize What Matters

Play Episode Listen Later Sep 27, 2022 12:26


Have you ever wondered about the chapter and verse numbers in your Bible? If they weren't put there by the original authors, who put them there? What was their reasoning? And most importantly - what does this mean for us as we memorize the Bible or simply use it in our day to day lives? Listen as Josh shares the back story behind the men who added these numbers to Scripture. Watch the Story (with visuals): https://www.youtube.com/watch?v=ukT67oNMFhE

Memorize What Matters
"Have I Not Commanded You..." (DON'T take it out of context!)

Memorize What Matters

Play Episode Listen Later Sep 20, 2022 5:12 Transcription Available


Before God gives Joshua the oft-quoted promise that He will be with him wherever he goes, there are a handful of other commands that don't get quoted. In this week's Moment of Meditation, Josh takes a closer look at the transition of power from Moses to Joshua and the key things God requires of Joshua *before* He promises to be with him. Dive in Deeper! This short devotional was first published in the Bible Memory Community, a gorup of 500+ people from around the world who gather online to encourage and inspire each other to hide God's Word in their heart. If you'd like to join us, you can do so for free here: https://www.biblememorygoal.com/join  You are also welcome to send any comments and feedback via our contact page: https://www.biblememorygoal.com/contact 

Memorize What Matters
STOP Following Me

Memorize What Matters

Play Episode Listen Later Sep 16, 2022 7:45 Transcription Available


This isn't clickbait. These are my honest thoughts as somebody who is building a Christian brand around Bible memory. Listen as I share why I might ask somebody to stop following me. If this resonates with you, let me know! Feel free to reach out to me on the website contact page, OR you can leave a review of the podcast. I read every review and appreciate your words of encouragement.

bible so grateful josh summers
Memorize What Matters
How a Caricature Artist Memorizes the Bible (w/ Jody Brownd)

Memorize What Matters

Play Episode Listen Later Sep 9, 2022 20:23 Transcription Available


How does a talented illustrator like Jody Brownd create imaginative, virtual memory palaces for Bible memory? Listen as Jody explains his illustrations, his approach to Scripture memory and where he gets his inspiration. See Examples of Jody's Work: Visit Jody's Website: http://www.bamsystem.org  Watch the Interview on YouTube: https://www.youtube.com/watch?v=5f-zNIEDXXg  Join Jody & Josh in the Bible Community: https://www.biblememorygoal.com/join/  You can also learn more about how people like Josh and Jody use more advanced memory techniques with these explanatory videos on the Bible Memory Goal YouTube channel: How to Use a Memory Palace: https://www.youtube.com/watch?v=t2VH-d8OuSM  Memorize Numbers w/ the Major System: https://www.youtube.com/watch?v=vkr-CiXnKX8 

Find The Magic
Nourishing Our Bodies: A Form of Self Care with Ali Essig

Find The Magic

Play Episode Listen Later Jul 5, 2022 39:52 Very Popular


Our bodies are our conduits for experiencing this life. It makes sense that caring for them from a place of love is a worthy investment for us. Self care is part of wholehearted living for both our body and our soul. Sometimes, when people talk about self care, they mention expensive hair products and elaborate pedicures. At Find the Magic, we are big fans of the kind of soul filling self care that is more about true fulfillment (think meditation, time with God, feeding our intellect, etc.). So, when it comes to our bodies, it makes sense that we like the idea of going beyond image based self care and going deeper into truly nourishing our body with foods and love. In this episode, Ali Essig, a plant-based holistic nutritionist and educator, gives us lots of priceless information on how vegetables and fruit are a beautiful, accessible form of self care. She gives practical tips on how to incorporate more of these life improving ingredients into our family's eating habits in a really simple and reachable way. You can find more from Ali at www.Plantwhys.com and on instagram @plantwhys She offers a $37 mini course and our listeners can get 20% off with the code: EATFORLONGEVITY RELATED EPISODES French Kids Eat Everything (and So Can Yours!) HOW TO Eat With Intuition Making Dinner Meaningful and Uncomplicated With Claire Tansey BOOKS AND LINKS WE MENTIONED The Blue Zones: 9 Lessons for Living Longer From the People Who've Lived the Longest // Dan Buettner EPISODE SPONSORS: Chamonix Skincare This amazing skincare line is clean, comfortable, and produces wonderful results. What makes them different from other skincare product lines? They use no mineral oil, petroleum by-products, pharmaceutical preservatives, coloring agents or other harmful ingredients commonly found in skin care products, and they never test on animals. They use only pure ingredients, including a variety of potent antioxidants, in synergistic combinations that reinforce the positive skin care effects of each ingredient. Their anti-aging skin care products, developed by a pharmacist, are proven to work, and are endorsed by numerous physicians. Visit them at https://betterskintoday.com and try their money back guarantee:) Organifi This weeks sponsor Organifi is loved here at Find the Magic for their whole food based supplements for that extra boost when your daily diet isn't up to speed! Felica loves mixing their “GLOW” collagen raspberry lemonade with their “Red Juice” for an energizing summer drink. Head to organifi.com/findthemagic for 20% off your entire order!” Thank you for the kind reviews! We appreciate them so much. Review of the week from kkaian: FOR ANYONE WHO WANTS TO BE A BETTER PARENT I look forward to this podcast every week. (and honestly wish it was more like a daily thing!) [They] are warm and welcoming. They really inspire me to be a better, more thoughtful mother. And they have helped me figure out how to ease a lot of the stress and overwhelm that can come with being a stay at home mom. I have listened and relistened to every episode. I truly feel like this podcast is a gift! So Grateful for all the life changing wisdom and ideas they share. Thank you!!! --- Support this podcast: https://anchor.fm/findthemagic/support