Podcasts about bolth

How did Christmas at the Johnson's go? Book stores in 2025. Baby barf on the dog's head. Getting the kid a square. The blue goopy boy! Vegas ready for friends? Red KitchenAid is here, and loads more! Hosted on Acast. See acast.com/privacy for more information.

How did Christmas at the Johnson's go? Book stores in 2025. Baby barf on the dog's head. Getting the kid a square. The blue goopy boy! Vegas ready for friends? Red KitchenAid is here, and loads more! Hosted on Acast. See acast.com/privacy for more information.

Vintage Culture's October 2024 edition of Culture Shock brings new music from CAMELPHAT, BOLTH, KEVIN DE VRIES, BORIS BREJCHA, CHRIS LAKE, VICTOR RUIZ, and more.

“It's an actual word, dude, I'd appreciate it if you'd recognize it as such…”   CORROSION OF CONFORMITY's 1994 masterpiece, DELIVERANCE, delivers the sonic equivalent of “Skynyrd Fried Sabbath” covered in ZZ Top gravy that instantly evokes visions of wood paneling, shag carpeting, weed, and November. In short, DELIVERANCE is the perfect soundtrack to fall. Discover the significance of “The Preamble” and understand why its importance desperately needs to be revisited. Get ready to “make it bigger” and go “busking in New York and/or Helsinki” because it's high time we end all the world's problems after you JOIN US for some “Halloween Candy ASMR” and an abundant assortment of silliness as we dig into COC's DELIVERANCE.   Visit www.metalnerdery.com/podcast for more on this episode Help Support Metal Nerdery https://www.patreon.com/metalnerderypodcast   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter Email: metalnerdery@gmail.com Can't be LOUD Enough Playlist on Spotify Metal Nerdery Munchies on YouTube @metalnerderypodcast   Show Notes: (00:01): “Perfect, fucking timing…”/ #introburpASMR / “By this time…when this is aired…”/ #prodcasting or #podcasting / “He may not be able to handle such power…”/ “That's why THAT dude wears the cape…”/ “Is this shirt slimming?”/ ***Check out the #metalnerderytruckerhat at our merch store at metalnerdery.com/merch ***/ #truckerhat / “I want ‘em to be red…”/ #burgundy / “Yes, please make it bigger…”/ ***WARNING: #listenerdiscretionisadvised *** / #WHOA / #ramblyandburpy / “I got a very different flavor…”/ “You did your job if she looked like this afterwards…”/ #fit / “It's FIT…”/ ***WELCOME BACK TO THE METAL NERDERY PODCAST!!!*** / “Why didn't they have an #erection?” / #therugs / “Fried rice, rugs, and kung fu…”/ ***To get to #themeatoftheepisode just go to #TheDocket or skip ahead about 30 minutes…*** / #backinsidethemetalagain / #RussellsReflectionsTypeOEdition / “The beauty about art…”/ “That was like a pre-chronicles Chronicles…”/ “How's the #soberoctober going?” / #checkpoint / “I am on a weight loss journey…”/ #NoBeerNovember / NOTE:  He lied…/ “A little bit of who?”/ “We can have a beverage…” / #ridiots / “It's an actual word dude, I'd appreciate it if you'd recognize it as such…”/ “Oh for fuck's sake…does it ever get tiring?” (12:00): #thisepisodesbeeroftheepisode #blackphilip / “Fuck your face…”/ “Thou's and Thee's…”/ #PatriceONealASMR #BlackPhilip / #TheVerdict / “It's almost like a sour…”/ “These are #glutenfree …”/ “It's 100% dick…”/ #bubbles / “4 out of 6…”/ ***PATREON SHOUT OUT!!!*** / #onmicburpASMR / “Burps to all of you!”/ #burpsupermix / #correspondence ***GO CHECK US OUT ON THE SOCIAL MEDIA AT #INSTAGRAM OR #FACEBOOK OR #YOUTUBE AT #METALNERDERYPODCAST OR EMAIL US AT METALNERDERY@GMAIL.COM OR GIVE US A CALL AND LEAVE US A VOICEMAIL AT 980-666-8182!!!*** / #voicemailsegment / #KenFromConnecticut / #namethatriff / “They're listening…so they know all the places…people you're talking to are already listening…”/ ***Leave us a REVIEW and some COMMENTS wherever you get our podcast!!!*** /  #TheYellowAlbum / #Metallica THAT WAS JUST YOUR LIFE (Death Magnetic – 2008) / “I think I know the riff he's talking about…”/ “It's like dating a 4 and then getting a smoking hot 10…” / #brickwalledmix / “Just play your drums…”/ “Is that what he does best though?”    (25:35): “I have some #shittah from Adam…”/ #Crisix (Full HD – 2022) / THE MANY LICIT PATHS / “Is that banjo?” / #banjtar / WE'LL PLAY YOUR SHITTAH!!! / “Me likey…”/ “Some of us stayed out and rocked our balls off until the wee hours…”/ #JoeRogan #LexFridman #podcastgiants / “You hit pause…and then you come back…”/ “I've got a question for you…”/ “Sometimes I kinda like watching them better…”/ ***We've got BOLTH!!!*** / “Do you have any NEW reflections?” / NOTE: It was 2 episodes ago. / #uhhhkay / “I think it's intents and purposes…”/ #intensivepurposes / #HalloweenCandyASMR / “They've got #ReesesPeanutButterCup #easycheese …”/ “If it's the apocalypse, why are you gonna get healthy?” / ***Check out our #Patreon Halloween episode!!!*** / #clicktrack    (37:37): “Thirty seven minutes in…”/ #TheDocket METAL NERDERY PODCAST PRESENTS:  CORROSION OF CONFORMITY – DELIVERANCE / #COC #CorrosionOfConformity #Deliverance #SouthernFriedSabbath / “COC has always been different…” / “Blind was the first…”/ NOTE: It was 1991, not 1990 / “The previous stuff was a lot more hardcore…it was kinda like what #SuicidalTendencies did…”/ “It did not compute…”/ “That's a good episode idea…”/ #futureepisodeidea / “You're really writing that down…”/ “I can't read your writing dude, when's the last time you got laid?”/ #killeropener HEAVEN'S NOT OVERFLOWING / “First album with Pepper doing all lead vocals…”/ #Preamble / “You know what else has a preamble?” / #learntoswim / “So pubes, basically…they're the preamble to the vag…”/ #stinkfinger    (46:26): ALBATROSS (“Break out the weed, man…”) / “Every time I hear this, it's wood paneling, shag carpets, weed, and fall…”/ “They should do some #LynyrdSkynyrd covers…”/ ***Check out our version of Albatross on metalnerdery.com/doomsicle *** / #goblincockASMR / “We're all kinda aliens in an earth meat suit…”/ “Would you haunt me with… #onehitwonders?” / #charliehorse / “Don't you have to ultra flex to get rid of it?”/ #bless / “It's got that cool stony, doomy vibe…”/ CLEAN MY WOUNDS (“That's how the story goes…in the land of a thousand No's…”) / #allthecokelines / WITHOUT WINGS (NOTE: Matt was wrong…what he's talking about comes later…) / “Very Sabbath…that's total Vol. 4 style right there…”/ BROKEN MAN (“And don't they wish they were blessed like you…”)    (58:27): “Lock the door…he's fine…”/ SENOR LIMPIO / “It kinda has a different mix…”/ “That's #ZZTop dude…big time.”/ “You mentioned the ZZ…”/ “New York? Or Finland?” / #TwixASMR / #BillyGibbonsASMR #Busking / MANO DE MONO / “Seven Mary Three?”/ #HandOfOne? / “I'll do it and send y'all pictures…”/ SEVEN DAYS / “That's deep…”/ “I need to go on a roadtrip…”/ “Here's your special whatever…”/ #2121313 / “That exists…it's a thing…this is it…I feel it in my balls…”/ “Here it comes…”   (1:08:23): “That was a record scratch!” / MY GRAIN / “That's #southernrock all day…”/ “That's some busy bass…”/ “I've got a revelation…without this version of COC, you could not have #TheSword…”/ #OnTheHunt #LynyrdSkynyrd / DELIVERANCE / “You can practically smell the weed if you sniff hard enough…”/ “ZZ Sabbath…”/ “The movie…is that a horror movie?”/ “It's scary because…we know people like that…”/ “By the way, ladies…”/ #stopjuststop #pleasestop #itssodifferent / SHAKE LIKE YOU (“Separate by class and keep the middle low…”) / #eclectic #whatsitcalled / SHELTER / NOTE: Every #countrymusicradiostation should play this song / “So once in a while, you'd be better, listening to fools for a change…” / #glamping #Doritos / “If you've got Doritos that's glamping…”/ #RussellsReflectionsCampingEdition / “When the shit goes down, this is my spot…”/ “Anything you work for…you appreciate more…”/ #trolling / “Making fun of the fish?”/ “A four hour tour?”/ “That's beyond fresh, that's fraesh!” / #lacesout  (1:23:40): PEARLS BEFORE SWINE / “I respect bass players dude…and you too…”/ “Look for the devils in their eyes…”/ “Kinda reminds me of the end of Blind a little bit…”/ NOTE: What is “Echoes In The Well”, Alex? / “I do a pretty good #RFKJrImpression …”/ “He's not a leftist…there's a difference…”/ “Most of those first people are actually the second people…”/ “Isn't it weird…?” / “There IS a difference…most people are in the middle…but we're being forced to be tribal…”/ #legalizedrugs #fairtax / “We just solved the whole world's problems…”/ #OperationOrangeTwits / “My vagina's a little sore…”/ THANK YOU ALL FOR JOINING US!!! / #TheAngryMatt / “There'll be cunt jokes for sure…I've got a #cuntchunk…”/ #untilthenext #outroreel  

Vintage Culture's October 2024 edition of Culture Shock brings new music from CAMELPHAT, BOLTH, KEVIN DE VRIES, BORIS BREJCHA, CHRIS LAKE, VICTOR RUIZ, and more.Culture Shock Intro 00:00:001. Vintage Culture & Vinter - High 00:00:472. deadmau5 - Strobe (Victor Ruiz Remix) 00:04:213. Andain - Summer Calling (BLR Remix) 00:09:414. Green Velvet - Percolator (Chris Lake Remix) 00:14:005. Sam Paganini - Rave (Boris Brejcha Remix) 00:18:046. Digitalism - Café Del Mar (Rework) 00:25:267. Bolth - Lines of Tomorrow 00:30:308. Mia Mendi, widerberg - In My Head 00:35:209. Vintage Culture & Goodboys - Chemicals (SCRIPT Remix) 00:38:2210. CAMELPHAT & Zafrir - The Advocate 00:42:4211. MRAK ft. Aimele Sophia 00:47:5412. Marasi – Opera 00:51:2613. Dyzen - Try (Mano Le Tough Remix) 00:54:4514. Kevin de Vries, Y do I - Saga 00:57:10

1991 was a year unlike any other. KFC changed their name to avoid paying royalties to the “trademarked” commonwealth for which they were named (whereas K-Y Jelly could not be reached for comment), Terminator 2:  Judgment Day was blowing up the box office as the number one movie in America, the first ever “world wide web” website was introduced to the world by Tim Berners-Lee, and just 6 days after that, on August 12th, 1991, Coroner's fourth album (Mental Vortex) AND Metallica's self-titled fifth album were BOLTH released on the EXACT same day.    It's time to get in the time machine and get ready to start “shooting ropes & painting walls” with our “squeezies” as we reveal the name of the band many have notoriously deemed “the hawk-tuah of metal”, as well as the frontman who resembled “a hot Canadian chick” (back in the day) before touring with Pantera, because we're going back to a time when high school was everything and the idea of retiring to the swingingest, most syphilis-infested subdivision in The Sunshine State was some abstract, fantastical, utopian concept that stretched far beyond the comprehension of our young, teenage, “brain snagged” minds.   “AwwwwwwwwwwwwwwwwwwwwwMannnnnnn” it's time to learn the key ingredients of “vampire jerky” and remember that “you can still rock with a high voice” (even if you've got on your “gloves of shame”). Find out where you DO NOT want to get “heartworms”, be sure to establish firm boundaries so you'll know exactly where “the aftermarket stuff stops with the ladies”, prepare to enjoy some “tangy flan” (courtesy of the outro-reel super-mix) and JOIN US as we reflect on all the fantastic metal released on August 12th, 1991 and the other 364 days of that year as we travel back in time to THE YEAR OF OUR RIFF LORD: 1991.   Visit www.metalnerdery.com/podcast for more on this episode Help Support Metal Nerdery https://www.patreon.com/metalnerderypodcast Leave us a Voicemail to be played on a future episode: 980-666-8182   Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter Email: metalnerdery@gmail.com   Can't be LOUD Enough Playlist on Spotify Metal Nerdery Munchies on YouTube @metalnerderypodcast   Show Notes: (00:01): #herewego (“The button's red…”) / #vampirejerky / “It's something new…”/ #DryJuly (“Wait…no lube?”) / #oldsmokey #rootbeermoonshine #thisepisodesclinkyoftheepisode / ***WARNING: #listenerdiscretionisadvised ***/ #theverdict / “At the tip…but the back end…”/ “It doesn't have #bubbles …”/ ***WELCOME BACK TO THE METAL NERDERY PODCAST!!!*** / “Wait, do it one more time…”/ #recordscratch / “It's called #discipline …”/ “Just six?”/ “Next money shot was like #PeterNorth …”/ #thisepisodesbeeroftheepisode #CreatureComfort #AthensGeorgia #Tropicalia #sixpointsixpercentABV    (05:58): #RussellsReflectionsASMR regarding the #NickelbackDocumentary on #Netflix / “Their influences totally make sense…”/ #stripclubcore / #billboardtopten / “That's probably why they're hated…”/ “Look at #KISS …”/ #songwriting / “You've got #OneLifeToLive …”/ “That's like a neighborhood…”/ “That's a metal label…”/ The #hawktuah of metal…/ #PATREONSHOUTOUT (Come and #JoinUs on the Patreon at patreon.com/metalnerdery ) / “Have a good June…”/ “He's so nice he joined us twice…”/ “Speaking of…we owe him a shirt.”    (13:47): If you want to send us some correspondence you can email us at metalnerdery@gmail.com or hit us up on #YouTube or #Instagram or #Facebook OR you can GIVE US A CALL AND LEAVE US A VOICEMAIL AT 980-666-8182!!! / #TripSix #WaxAudio (CONFIRM THE NAME) #MuttLange / #isitgay? / “I beg to disagree…”/ #clonesex / “Do they push too far?” / “Does he fuck an octopus?” / #octopushandy vs #peanutbutter / “It's only gross if you…”/ #youreworse #hogstoryparttwo / “I need a shower…”   (19:12): #TheDocket / “What were YOU guys doing in #1991?” / METAL NERDERY PODCAST PRESENTS:  1991 – YEAR IN METAL / ***check out our 1994 episode and our 3-part 1990 episode (30 years in metal) ***/ “Everybody knows what came out in '91…”/ NOTE:  That was March 1992, not 1991. / “Loads everywhere when they came to Atlanta…” / “They had to appeal to all the cooze out there first…”/ “Start off soft and get harder…” / #naturalprogression / #SkidRow SLAVE TO THE GRIND / “I just had a realization…”/ #OzzyOsbourne (MS? “Something happened in '91…”) #allegedly (“I think you just like saying tinker…”) / “They should map over their #cokelines from prior releases…”/ MR. TINKERTRAIN (“Now it does.”) / “Squeezies?” / “Settle your ass…” / #blackdog   (30:12): “We should play something thrashy…”/ “Stop with the yawns, dude…”/ “We're gonna move to that #Florida #SwingingNeighborhood …”/ #roastbeefjerky / #TheVillages / “Isn't that an old school #STD?” / “If the sores aren't there, you're good to go…”/ “AIDS part 2?” / #Athiest MOTHER MAN and some #GhostStory #tangentionalality / #Entombed LIVING DEAD / “It works for them…”/ “The drum mix reminds me of #TheMasquerade …”/ “Let's change things up a little…” / #Primus TOMMY THE CAT (“That's '91 all day long…”) / “And I say unto thee…”/ “They get MY Nickelback hate…”/ #ArmoredSaint (“I'm sorry, who's bush?”) / “Where does the #aftermarket stuff stop with the ladies?” / REIGN OF FIRE #powermetal / “This is a #soundtrack song…” / “He sounds like a younger #JohnBush / “It just seems weird for '91…” / “Things got progressively lighter…” / “Radio kills every star…” / “The song about the dead girlfriend?” / #readthoselyrics   (43:58): #Death SUICIDE MACHINE / “Everything's busy…”/ “I think we did that before we started calling it #InsideTheMetal …”/ “What would be a deep cut, if you had to pick one?” / #Sepultura ALTERED STATE / “It reminds me of #CrashBandicoot and #PlayStationOne …”/ “This almost sounds like a soundtrack tune…”/ #TypeONegative UNSUCCESSFULLY COPING WITH THE NATURAL BEAUTY OF INFIDELITY #IKnowYoureFuckingSomeoneElse (“Slam on the brakes!”) / #AwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwMannnnnn (“What a break down…”) / #justafriend / “That's straight up doom right there…”/ “Hey don't think I don't know what you're doing, you stupid twat!” / #HalloweenVibesASMR / Reflecting on the first time we ever saw #TypeONegative live at #TheInternationalBallroom / #MonsterMagnet (“'94, you were way off!”) MEDICINE #usethoseheadphones    (57:57): #TheAccused had an album in '91, right? / “No, it's not funny, but what's hysterical is…”/ “They all sound like that?” / NO HOPE FOR RELIEF (“That's the #weedlywoo of drums…”) & SATURDAY NIGHT SPECIAL / “Vocals by TAZ…”/ “Where do we wanna go next?” / “I feel like Bill likes #TheBlackAlbum as much as he likes #KISS…”/ #Coroner METAMORPHOSIS (NOTE:  #TBA and #MentalVortex #bolth came out on August 12, 1991) / “A dude named Stacey?”/ #HallowsEve / “What in the world?” / “Can you imagine #FDR introducing #WinstonChurchill as #AdolfHitler?” / “Have you seen the dick on that motherfucker?” / #Venom TRIBES (“That's not #Cronos …”)   (1:11:00): “Just for fun…” / #FatesWarning (“They're part of the Big 3 or 4 of #progressivemetal I think…”) / POINT OF VIEW (“That's kinda rockin'…”) / “Get ready for the #highsinging …” / #glovesofshame (“It sounds like #OperationMindcrime …”) / “Nobody said I was a singer…”/ “What's your favorite?” / THERAPY / “Can we hear the very intro of MONSTER SKANK?” / “We've got a lot to go here…”/ “You've gotta play #COC …”/ #CorrosionOfConformity WHITE NOISE (“This is probably their only real thrash album…”) / “That's European American privilege noise…”/ “Number 1 #Billboard single, 1991…” / #itsnotmetal / “Y'all bang to that?” / “Those were all the metal bands that made it…”/ “Is that what happens when…cut themselves?” / #sackful #Krystals / “Really good bad…”/ “You see all the people getting shot ordering food in the drive thru these days?” / “Oh boy…all the pressure…”/ #Metallica OF WOLF AND MAN / “No shape shift or nothin', huh?” / #Overkill BARE BONES (“It's #Halloween …it's not but it makes you think of it.”) / “You may be right, and I may be crazy…”/ NOTE:  see also #KingDiamond #Them OUT FROM THE ASYLUM / “And for fun…the Halloween theme?” / “Is that a #threesome…does it count?” / “It's coming right before #theendoftheworld …”/ “Y'all are too white to say that…”/ #markthetime please…/ “Once we get bigger than Rogan…” / “Oh yeah, he ripped off #BillHicks persona, set, etc…he stole everything from Bill Hicks…”/ “#DietBillHicks is what you saw…”/ “How are we looking on those #OperationOrangeTits shirts…”/ #3DCheetos / ***THANK YOU ALL FOR JOINING US AND THANK YOU TO OUR PATREONS FOR YOUR SUPPORT!!!*** / #GrungeNerderyPodcast / ***COME ON DOWN TO THE #BUNKERPOONGIFTSHOPPE AND PICK UP SOME #METALNERDERYPODCAST MERCH AT metalnerdery.com/merch *** / #outroreel #supermix #pissandpennies  

Biztosan van, aki felhúzza a szemöldökét, hogy miért BiotechUSA egy magyar cég neve, de a videóból kiderül, hogy miért is maradt ez. Ez az a magyar sikersztori, ami azt gondolom dobogós helyen lesz akkor is, amikor szavazást intézünk felétek ebben a Sikeres cégek videósorozatban. Van itt minden, jó ötlet, új generáció megjelenése, dizájnváltás, gyár létrehozása, külföldi piac meghódítása, nem is kicsit! És akkor a konkurencia felvásárlásáról még nem is beszéltünk, amit "aprópénzért" sikerült a cégnek megszereznie. És ennél a cégnél imádnak dolgozni a munkavállalók! Meghallod a videóban a fluktuáció %-ot, egészen biztosan irigyelni fogod őket. Ez az! Ilyen cégekre van szüksége Magyarországnak! A videóban erről van szó: (0:00) BiotechUSA, 30 éves magyar cég (1:37) Az alapító apuka, kondigépektől a fehérjeporig (2:15) Márkanév megtartása (2:44) Bolthálózat elindítása, offline marketing (3:23) Alapító fiai és a saját bizniszük a Shaker-Store (4:05) Generációváltás, új korszak a cégben, új termékek, új irányok (5:11) Konkurencia felvásárlása, Scitec-et megvették (5:54) Több tízmilliárd forint forgalom, több milliárd nyereség (6:59) Mitől megy nekik ilyen jól? (9:07) Tud ez még nőni? További hírekért és izgalmas üzleti tartalmakért irány a Minner: A videóban erről van szó: 0:00 BiotechUSA, 30 éves magyar cég 1:37 Az alapító apuka, kondigépektől a fehérjeporig 2:15 Márkanév megtartása 2:44 Bolthálózat elindítása, offline marketing 3:23 Alapító fiai és a saját bizniszük a Shaker-Store 4:05 Generációváltás, új korszak a cégben, új termékek, új irányok 5:11 Konkurencia felvásárlása, Scitec-et megvették 5:54 Több tízmilliárd forint forgalom, több milliárd nyereség 6:59 Mitől megy nekik ilyen jól? 9:07 Tud ez még nőni? További hírekért és izgalmas üzleti tartalmakért irány a Minner: https://minner.hu/

This week Vintage Culture plays new tracks from Anyma, Layton Giordani, HNTR, Kölsch, Rebūke, Bolth, Cristoph and some tracks from his new album, ‘Promised Land'. 01. Vintage Culture - Find A Way 02. Vintage Culture, Braev - Time 03. Rebūke - Along Came Polly (Konstantin Sibold, Carmee & ZAC Remix) 04. Bolth - Arcadia 05. Peer Kusiv - Air 06. HNTR - Technoelectronic 07. Cristoph - Signal 08. Arude - Nocturne 09. Layla Benitez, Eynka - No Place To Go 10. Airwolf Paradise ft. Paul Johnson - Only Man 11. Kolsch & Goldtrix ft. Andrea Brown - It's Love (Trippin') 12. Vintage Culture, NoMBe - Pleasure Chasers 13. Vanillaz - Azmara 14. Sharam - Party All The Time (Adam Beyer, Layton Giordani & Green Velvet Remix) 15. VisionV, Flylo, Nathan Nicholson - Sign of The Times (VIP Mix) 16. Loofy - Last Night (Anyma x Layton Giordani Remix)

00. Alex MAVR - Intro 01. MaMan, MARYN - Feeding the Fire 02. Portugal. The Man feat. Jeff Bhasker - Time Is A Fantasy (Anyma Remix) 03. John Dare - The One For You 04. Anza & Alon Halperin - Hypnotherapy 05. Silver Panda & Sevenn - Welcome The Night (Extended Mix) 06. Mirel Cipu - Escape reality (Extended Mix) 07. Anyma (ofc), Sevdaliza - Samsara (Extended Mix) 08. Estiva - On The Line (Extended Estiva Club Mix) 09. Y.Y - Jupiter 10. MarynCharlie & MaMan (NL) - Feeding the Fire (Passenger 10 Extended Remix) 11. Silver Panda - Human Heart 12. Gorgon City & Julia Church - A Lot Like Heaven (Space Motion Extended Mix) 13. Kevin de Vries - Dance With Me 14. Daniel Neuland, Vom Feisten - Horizon (Vakabular Remix) 15. Brian Don - Outlier 16. Redspace, ISMAIL.M - Kundalini 17. Bigfett - United (Extended Mix) 18. LITCHI, MonAmourrr, ANZA - Fahrenheit 3000 19. Normtone, Anza - My Vision 20. Grigore - Strange World (Extended Mix) 21. Zafrir - GATE 22. Bolth, Airsand, TuraniQa - Still Alone

This week Vintage Culture plays new tracks from Anyma, Layton Giordani, HNTR, Kölsch, Rebuke, Bolth, Cristoph and some tracks from his new album, ‘Promised Land'. Culture Shock Intro 00:00:001. Vintage Culture - Find A Way 00:00:422. Vintage Culture, Braev - Time 00:04:463. Rebuke - Along Came Polly (Konstantin Sibold, Carmee & ZAC Remix) 00:09:234. Bolth - Arcadia 00:13:305. Peer Kusiv - Air 00:16:006. HNTR - Technoelectronic 00:20:307. Cristoph - Signal 00:25:008. Arude - Nocturne 00:30:459. Layla Benitez, Eynka - No Place To Go 00:34:1510. Airwolf Paradise ft. Paul Johnson - Only Man 00:37:0011. Kolsch & Goldtrix ft. Andrea Brown - It's Love (Trippin') 00:41:0012. Vintage Culture - Pleasure Chasers 00:45:1513. Vanillaz - Azmara 00:47:4514. Sharam - Party All The Time (Adam Beyer, Layton Giordani & Green Velvet Remix) 00:49:4515. VisionV, Flylo, Nathan Nicholson - Sign of The Times (VIP Mix) 00:53:0016. Loofy - Last Night (Anyma x Layton Giordani Remix) 00:55:30

00. Alex MAVR - Intro 01. MaMan, MARYN - Feeding the Fire 02. Mirel Cipu - Escape reality (Extended Mix) 03. Kikkx - Not Shiva 04. Silver Panda & Sevenn - Welcome The Night (Extended Mix) 05. Peggy Gou - (It Goes Like) Nanana (Alexey Union & ETNE 2023 Remix) 06. John Dare - The One For You 07. Gaba Kamer, Fuscarini - Zero Problems 08. ASHER SWISSA - Closer Enemy (Extended Version) 09. Fuenka - Ikaros (Extended Mix) 10. Aramitt - Dune 11. Ruback - THE UNKNOWN (Extended Mix) 12. ANZA, DJ Nejtrino - Fade To Grey 13. Bolth, Airsand, TuraniQa - Still Alone 14. Lowren Ros - Again 15. Space Motion - Hera 16. Artmasteria - Chris Avantgarde Anyma (ofc) - Eternity (Extended Mix) 17. Vivo, Ñarkiš - Abba Shimon feat Narkis (Extended Mix) 18. Tom Keller - Where Are You Now 19. Terry Golden - Afraid 20. Mully, Shvman, Robbie Rosen, RAM6, Denis Kenzo - In The End (Denis Kenzo Extended Remix) 21. Moritz Hofbauer - Your Eyes (Extended Mix) 22. Diego Miranda & Massivedrum - Supernova (Extended Version) 23. Spirit Tag feat. Starky 47 - Delusion

Full show - Thursday | GMD - Best woman | Should T. Hack learn how to cook? | Bolth | Bad babysitter | Slacker's first date | T. Hack's son has a crush @slackerandsteve @thackiswack @radioerin

Slacker has a really hard time pronouncing this word...and now he's getting recognized for it.

01. Kikkx - Not Shiva 02. Cary Crank & OBL - Coldfire (Etonika Remix) 03. Airsand & TuraniQa - Rave Is The Future 04. Bolth, Airsand, TuraniQa - Still Alone 05. Anyma - Explore Your Future 06. DJ Nejtrino & Anza - Right In The Night 07. Gorgon City & Julia Church - A Lot Like Heaven (Space Motion Extended Mix) 08. Diego Miranda & Massivedrum - Supernova (Extended Version) 09. KARPOVICH, DJ VEDO, ALAIN FANEGAS - LSD 10. Moritz Hofbauer - Your Eyes (Extended Mix) 11. Kevin de Vries - Dance With Me 12. Mully, Shvman, Robbie Rosen, RAM6, Denis Kenzo - In The End (Denis Kenzo Extended Remix) 13. MaMan, MARYN - Feeding the Fire 14. Portugal. The Man feat. Jeff Bhasker - Time Is A Fantasy (Anyma Remix) 15. Steve Levi - Yes! 16. Terry Golden - Afraid 17. The Khitrov, Obozov - Phenomen (Maze 28 Remix) 18. Space Motion - Hera 19. ISMAIL.M, Maze 28 - Chain Reaction (Extended Mix) 20. Tom Keller - Where Are You Now 21. Vivo, Ñarkiš - Abba Shimon feat Narkis (Extended Mix) 22. Spada, Lauren L'aimant - Gone 23. Spirit Tag feat. Starky 47 - Delusion

SPEKTER presents SPEKTRUM RADIO, bringing you the hottest new sounds in tech house, minimal tech, and deep house. From the rising stars to the underground's newest emerging artists, SPEKTER has dug deep to bring you not just their favorite tracks, but tunes that are sure to get your body moving and your soul vibing. This week features tracks from James Hype, Westend, Max Styler, Keepsix, ACT ON, Mauricio Traglia, Dark Heart, Bolth, and more. TRACKLIST: WESTEND, MAX STYLER – RHYTHM MACHINE DARK HEART, BOLTH – THE RHYTHM LEO SMY, GIDDIBANGBANG – SHE'S A FREAK SINO – HOLD ME CLOSE TYLA – WATER (JAMES HYPE EDIT) STARWOODZ – DANCE TO GROOVE MAURICIO TRAGLIA – CAKE FRED AGAIN, BABY KEEM – LEAVEMEALONE (SUBSHIFT EDIT) GURU JOSH PROJECT – INFINITY (DJ PROPHET REMIX) STEREOCLIP – SUNSET DRIVE (CALUSSA REMIX) SPEKTER – ENDS BAD BUNNY – MONACO (KEEPSIX EDIT) ODEN & FATZO – LAUREN (ACT ON EDIT)

The weekly radio show from Salvione, blending house, funk, and tech, resulting in an unparalleled energetic dance floor vibe. Leandro Da Silva, Alterboy ft Sam Stray Wood & Kiirah - ZombieJengi vs Classmatic - Toma Mercy (Valmar mashup)Leandro Da Silva - Go Bananas (Carolin Cole Remix)DJ Snake, Wade, Nooran Sisters - Guddi RiddimAlterboy, Thorn - EverybodyAERIX X Avensis - MamacitaLollow - VoodooDimitri Vegas - The White Lotus ThemeEssel vs Hugel - Lennon Tra Tra (Leandro Da Silva mashup)Bolth, Jae_Walter - SacrificeTECH IT DEEP - Maria MariaHakes - CalienteLil Wayne, SIDEPIECE - A Milli (SIDEPIECE Remix)Milk Bar - Love VibrationSamii, Frank Master - IllusionsShermanology - BackfireRoxe - Dara Dum

Vintage Culture brings the noise with new music from Cassimm, Anyma, Chris Avantgarde, Rebūke, Bolth, Diplo, Hugel & Tube & Berger. 01. Rafael - That Girl 02. Rebūke - Rise 03. CIOZ - Shaka 04. Cassimm - Love Desire 05. Bolth - Chatoyant 06. Dark Heart & Bolth - The Rhythm 07. Vintage Culture, Tube & Berger, Kyle Pearce - Come Come 08. Bolth - Never Surrender 09. Goom Gum - Soma 10. Diplo & HUGEL - Stay High (HUGEL Version) 11. Anyma & Chris Avantgarde - Simulation 12. Cassian - Aran 13. Khainz - The Answer To Everything 14. Dyzen, Sideral - Dialogue

This week, Vintage Culture shares dope new music from Cassimm, Zhu, Max Styler, Anyma, Bolth, Tommy Farrow, Khainz & more. 01. Bolth - Absence of Mind 02. Anyma & Argy & MAGNUS - Higher Power 03. Bolth - Floral Hole 04. Max Styler - Hypnotic 05. Ellis Moss - Calling 06. Cloverdale - Deeper & Deeper 07. Cassimm - Love Desire 08. Vintage Culture, Tube & Berger, Kyle Pearce - Come Come 09. ZHU & Wax Motif - Better Recognize 10. Holt - World's Perception (Enai Remix) 11. Tommy Farrow - Her 12. Meduza - Musica 13. Riordan - Needle On The Record 14. Khainz - Complications 15. Nitefreak & Emmanuel Jal - Gorah

1.Forbidden Fruit - Garden of Eden (Nico Morano Remix) 2.Alexey Union, Jon.K - Gobi 3.Camilo Sanjuan - Cabeza de Vaca (Rigopolar Remix) [RedFader] 4.Silver Panda - Soul Connection (Gorsky, Invariant Remix) 5.Moonwalk, Alessio Cristiano - Eternal 6.Moonwalk, EarthLife - Zoe 7Laherte - Gate 8.Mpathy - Spike (Extended Mix) 9.RoelBeat, Katrin Kittyx - Cosmic Ride 10.Moonwalk & EarthLife - Dark Waves (Extended Mix) 11.Dani Hageman - Hello 12.Avis Vox - Back Me My Freedom (Extended Mix) 13.Colyn - Cyclone 14.Underspreche - Il Canto Delle Fate 15.Jono Stephenson - Can't Get Up 16.Henri Bergmann, Hardt Antoine - Can't Escape 17.Delerium - Silence (Stone Van Brooken, Pete K Extended Mix) (feat. Sarah McLachlan) 18.t'Awi - Humancity 19.BOLTH & AIRSAND & TURANIQA - Still Alone 20.Keistep - Hypnotized (Original Mix) 21.Delux Twins & Rass (BR) - Satya (Extended Mix) 22.Chapa X - Doppler (Original Mix) 23.Victor Ruiz Alex Stein - human Robot 24.Nuage - Red Line (Tim Engelhardt Remix)

Follow me: Facebook: fb.me/xabionly Twitter: twitter.com/xabionly Youtube: youtube.com/xabionly Mixcloud: mixcloud.com/xabionly Instagram: instagram.com/xabionly TRACKLIST: https://1001.tl/2hlzsx4k Spotify playlist: https://open.spotify.com/playlist/4STV7DPVgwI4ntvi1sQvjh?si=CU6lCNZcRkKiZytdXaI5TQ Follow GINCHY: https://www.instagram.com/iamginchy/ https://linktr.ee/Ginchy TRACKLIST: GINCHY: 01. Ginchy & ID - ID 02. Ginchy - Zero Count Fade [GINCHIEST] 03. Ginchy - Relief [BUTTERFLY EFFECT] 04. Ginchy & Tellur ft. Steve Blaik - Never Win [UV NOIR] 05. Ginchy - Haunted [FORCE OF HABIT] 06. Das Pharaoh & Ginchy - ID 07. Tomcraft - Loneliness (Ginchy Remix) 08. Ginchy - Embers of Hope [GINCHIEST] 09. Ginchy - You're Not Alone [SPINNIN] 10. Ginchy - Leading You [BLACK HOLE] 11. Ginchy & GXD ft. Yasmin Jane - As The Rush Comes [GINCHIEST] 12. Ginchy - ID XABI ONLY: 13. AN21 - Liquid Gold [SIZE] 14. Wankelmut ft. EMIAH - Just The Way I Feel [FUTURE HOUSE MUSIC] 15. Fedo - Boom 16. Frank-lo & 4Step ft. Ariel El Leon - Fujitivo [ARTWRK] 17. Galoski - Do It Like That [UNLIMITED FUEGO] 18. Choujaa & Idd Aziz - Chappa [CAFE DE ANATOLIA] 19. Joel Corry x MK x Rita Ora - Drinkin' (Joel Corry Mainstage Mix) [ATLANTIC] 20. Megisto & A!EN - Run Boy Run [SELF] 21. Voster & Gallardo x Severman - Holding On To You [GENERATION SMASH] 22. Odssey x Ferrigno - Push Me Away [SMASH DEEP] 23. Anyma - Chordial [AFTERLIFE] 24. Nerve, Zack Torrez & Kellen Pars ft. Jetason - After The Storm [FEELQ] 25. ASHER SWISSA, Lynn - Roses From The Ex [DHARMA] 26. eeyrith., Noir Fonce, Ztoyu - Leave Me [FEELQ] 27. SwitchBlade & Infinite - Lay You Down 28. Dallerium, Able Faces, MCN2 - Shadow Chasing [CONTROVERSIA] 29. Bolth, Joy Rivo & Jto - Ordinary World [MAGNIFICO] 30. HI-LO & Eli Brown - RIDE OR DIE [HILOMATIK] [PROMO OF THE WEEK] 31. 71 Digits x Flo Rida - Low (Macon's HYPERTECHNO Remix) (Instrumental Mix) [SPINNIN] 32. Rudeejay x Ninkid - Freed From The Whole [MINUTE TO MIDNITE] 33. ALOK & The Chainsmokers ft. Mae Stephens - Jungle (VIP Mix) [COLUMBIA] [TRACK OF THE WEEK] 34. Swedish House Mafia - Ray Of Solar (Anfisa Letyago Remix) [SSA] 35. KSHMR & Maddix - Close To You (Audiotricz Remix) [DHARMA / EXTATIC] 36. Dimitri Vegas & Like Mike x David Guetta x Afro Bros x Akon - She Knows (Per Pleks Remix) [SMASH THE HOUSE] 37. Gabry Ponte ft. Datura - Destination Infinity (Instrumental Mix) [SPINNIN]

Vintage Culture delivers a brand new episode of Culture Shock with tracks from Crusy, Black Circle, Bolth, CamelPhat, Cristoph, Maceo Plex and Adriatique. 01. Maceo Plex, AVNU (UK) - Clickbait 02. Patrick Prins - Le Voie Le Soleil (Solardo Remix) 03. Bolth, ID - Ordinary World 04. VisionV ft. PHEA - Lonely [Philipp Straub, Outcome Remix] 05. Cristoph - Come With Me 06. Crusy x Alex Now (ES) - The Loop 07. Samuel Sonder & Nicholas Steinbach - Dark Hymn (Erik Lucas Remix) 08. CamelPhat ft. Ali Love - Compute 09. Adriatique & WhoMadeWho - Miracle 10. Vintage Culture - Tudo Bem Tudo Bom 11. Black Circle - Essence 12. Kolombo - Ring The Bells (Devotionz Remix) 13. Crusy - The Middle 14. Bolth - Shattered Ego

Compiled and Mixed by Cary Crank @carycrank Listen at your preferred platform: podlink.to/PLTSTORIES Tracklist: 1. Cary Crank - Lost Highway (Original Mix) 2. Bolth, Airsand, TuraniQa - Still Alone (Original Mix) 3. MPathy - Spike (Cary Crank Remix) 4. ZERO CONTACT - Beyond the Clouds (Rauschhaus Remix) 5. Cary Crank - Don't Walk Away (Extended Mix) 6. Cary Crank, DJ Helius feat. Aves Volare - Empty Space (Original Mix) 7. Kamiel Kiko - Over (Original Mix) 8. Eddy Tango - Running Time (Original Mix) 9. Avidor - Virgo (Cary Crank Remix) 10. SHAZZE - No Time To Waste (Nihil Young Remix) 11. Indifferent Guy - Andromeda (Extended Mix) 12. Fireblast - Black Sky (Original Mix) Enjoy Listening. Website - www.polyptychmusic.com Soundcloud - @polyptychmusic Facebook - www.facebook.com/polyptychmusic Instagram - www.instagram.com/polyptychmusic Twitter - www.twitter.com/polyptychmusic If you want to keep track of how your music "works" (to which playlists the tracks in Spotify, Apple Music, Deezer, and others are added; in what positions in TOPs on Beatport, Traxsource, iTunes, and others are your tracks or release, as well as finding releases on the main store pages; which TOP DJs play your tracks; and much more), feel free to use the Songstats service. ❗Actual and works for Artists and Labels❗ You will get a Lifetime Discount of 10% on your account through our link => songstats.com/?ref=POLYPTYCH

Escape reality with this week's Culture Shock featuring new music from Artbat, John Summit, Anyma, Mochakk, Bolth, Franky Wah, Tiga, Kölsch & Vintage Culture! 01. Vintage Culture - Tudo Bem Tudo Bom 02. Tiga & Kölsch - Hand In Hand (Rebūke Remix) 03. Terry Golden, Black Box - Otherside 04. RUBACK, Sevenn - Riders on the Storm 05. Marasi - Tormenta 06. Bedouin - Tijuana (Vintage Culture Remix) 07. Solardo & Mandalo - Lemon & Lime 08. Franky Wah - 55 09. Bigfett - Signals 10. Bolth, Airsand & TuraniQa - Still Alone 11. Mosimann - Balek 12. Mochakk - Jealous 13. Portugal. The Man - Time's a Fantasy feat. Jeff Bhasker (Anyma Remix) 14. ARTBAT feat. John Martin - Coming Home 15. John Summit ft. MKLA - Fade Out

Lose yourself to new music from Rebūke, Yotto, Booka Shade, Bolth, Anyma, Miss Monique, Franky Wah & Vintage Culture. 01. Adam Ten & Maori - Spring Girl 02. KA$$ - The Mind 03. Franky Wah - Are You Down 04. Spencer Brown & Qrion - 20ms 05. Mojjo & Bhaskar - Zombie - North of Neptune 06. BLOND:ISH x Eran Hersh x Darmon, Madonna - Sorry (Miss Monique Remix) 07. Anyma & Rebūke - Syren 08. Bolth, Airsand & TuraniQa - Still Alone 09. Product Of Us - Just A Little More Love 10. Vintage Culture - Tudo Bem Tudo Bom 11. Yotto & Booka Shade - Encounters (SOHMI Fantasy Remix) 12. ID - Breathe 13. Rebūke - Echoes 14. KA$$ - Into the Future 15. Maxim Lany & Pretty Pink - What If I Want You 16. Weval - Forever (Solomun Remix)

BULTEN!

QOTSA, aka QUEENS OF THE STONE AGE, began back in the late “Nineteen Hundreds” in Seattle, Washington following the breakup of Josh Homme's former band, desert metal legends Kyuss. With a wide array of sonic textures, layers, and sound design sorcery ingrained within their music, as with Kyuss, QOTSA is another prime example of a band whose albums should be listened to and enjoyed via headphones (and if we're being honest, since “this show is about honesty”, a healthy infusion of relaxers will help to further enhance this experience). It's time to realize which nationality's coitus “sounds delicious” and understand that the pain of regret from a disappointing high gravity brew rivals the pain of regret that comes from copping a squat “on your balls”.  Prepare to bear witness to one of the greatest alcohol “collabs” ever imagined and discover the powerful allure of food truck fare when you JOIN US as we get outside the desert and go inside the metal with none other than QUEENS OF THE STONE AGE.   Visit www.metalnerdery.com/podcast for more on this episode Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com Can't be LOUD Enough Playlist on Spotify Metal Nerdery Munchies on YouTube @metalnerderypodcast QOTSA on the Interwebs: https://qotsa.com/   Show Notes: (00:01): “You guys missed a BUNCH of stuff…” / #moneyshot / “There's a #DallasTexasBased #ACDCTributeBand #BackInBlack (Wait, Axl Rose!? Seriously!?) / “He can do BOLTH voices perfectly!” / “If I was Mr. AC/DC…” / “That's when all the cool shows happened…” / “He sat on his balls…” / #happyfourth / ***WARNING:  #listenerdiscretionisadvised *** / ***WELCOME BACK TO THE METAL NERDERY PODCAST!!!*** #tothelandoftheyeah #bunkerpoonunlimited #inthebunker / #thisepisodesbeeroftheepisode (“I'm still trying to power through mine…”) / “That's what this show's about…it's about honesty…and metal.” / #hihoneyASMR / #thisepisodesbeeroftheepisode / #SweetwaterGummiesIPA #ninepointfivepercentABV (“that's the only thing…”) #onmicburp (“tastes like #badcoughmedicine sans narcotics”) / “This is not one of them…” / #markthetime / #GoldenGreyGoose (“Dude, they should have a #collab!”) / #GoldenGoose / #ASMR / “I can never go to a camera store again ever…” / #businessplanning and #jokecollabs and #tshirts / #tourshirts #withdates #tshirtdesignASMR (“Did they just play that album?”)    (09:25): #Pantera on tour…good turnouts & favorable reviews / #No / “I think the only way I would have loved that…” / #GeritolTheater (“Do they show tits at #TheCureConcerts?”) / “Dude, Italian intercourse sounds delicious…” / #scampi #gahlic #spicygahlicscampi / #foodtrucks / #bakedpotatoes (“You can do so much…and they're good for you…”) / #potatobomb #ChernobylFarms #massivepotatoes #yuge (“I've got #foodbone right now… I can't stand it…”) / #runningoutofboner / “The whole #nipflashing thing…” / #thesnaps / #markthetime / #RussellsReflections #TheCureInConcert #TheCureASMR #SadMusicForSadPeopleASMR #ExpensiveVices (“…for 2 drinks, this size!”) / “What kind of fucking shit is that!?” / #dontworryaboutit (“I've seen #TheGodfather” …)    (20:00): #secretmenu #realmexicanpizza (“Not that fuckin' fake bullshit…”) / #TheDocket / METAL NERDERY PRESENTS:  QUEENS OF THE STONE AGE – INSIDE THE METAL (#QOTSA) / Exceptionally good with #relaxers / “Lots of desert, stoner stuff…” / “It's basically 90's metal.” / #hugepubes #yugepubes #corporationarena (“I thought that she was…”)    (23:32): Queens of the Stone Age (1998) / “I like the way he says #boobs (and/or #bewbs)” / #killeropener #firstnewalbum REGULAR JOHN #crooningASMR IF ONLY (“A little before it's time…”) / The perspective of time and 23 years:  1977 to 2000 vs 2000 to 2023. / Seeing the passage of time (“In the 1900's…”)    (29:43): #bunkerpoonthememusic Rated R (2000) / FEEL GOOD HIT OF THE SUMMER (“I think I'm like 6 for 7 on that list…”) / “Nobody could ever tell me…” / #euphorichallucinogenic #yes / THE LOST ART OF KEEPING A SECRET / QUICK AND TO THE POINTLESS (“I don't even know…what…I'm doin' here…”) / BETTER LIVING THROUGH CHEMISTRY (“This is creepy…”)    (36:54): “It came out of nowhere…” / #phenomenon #breakoutalbum Songs for the Deaf (2002) / GO WITH THE FLOW / #screenoftits (“that's the name of our first album, dude…”) / A SONG FOR THE DEAF / “Go to about the ½ way mark…” / #darkandcreepyASMR / “#youguys #ericcartmanASMR / “You could basically imagine it with that…” / “Have you noticed…?”    (43:38): Lullabies to Paralyze (2005) / “I know it sounds petty…” / LITTLE SISTER (“Hello Doro…”) / “was it #thehotcarlsonreview?” / “If I've gotta talk you through it…the moment's ruined.” / BURN THE WITCH #fuzzybass / “I gotta request, man…” / YOU GOT A KILLER SCENE THERE, MAN… / How to improve your blunts…   (48:45): Era Vulgaris (2007) / #retrovibe SICK, SICK, SICK / MAKE IT WIT CHU / TURNIN' OF THE SCREW #veryfuzzy / …Like Clockwork (2013) /Great Fauci impression… #DanaCarveyASMR (“He's like our generations' #RichLittle”) / I SAT BY THE OCEAN (“Remember your training…”) / MY GOD IS THE SUN / “Wait…wasn't “Villains” somewhere in there?”   (56:46): “that was when I was still working & functioning and…gobbling those things down like #PEZ” / “Eyeballs in the fists…” / Villains (2017) / #killeropener (“Excellent buildup…”)  FEET DON'T FAIL ME #greatatmosphere / Regular lights vs black lights / THE WAY YOU USED TO DO #seventeenASMR / “He was straddlin' it…” / FORTRESS #relaxersASMR (“Definitely has a 70's thing going on…”)   (1:04:56): “Is it fucked up that I wanna order a pizza and THEN go do the #foodtruck thing?” / In Times New Roman… (2023) / PAPER MACHETE #leadoffsingle / “That one looks good…” CARNAVOYEUR (80% of the #cokelines) / “You have to listen to the whole album…” / “My balls are very full…and my stomach is very empty…” / #QueensOfTheMomScrewin and/or #QueensOfTheStoneAge #QOTSA / #ohmy / ***THANK YOU FOR JOINING US FOR THIS EPISODE OF METAL NERDERY PODCAST!!!*** #untilthenext ***VISIT THE BUNKERPOON GIFTSHOPPE AT metalnerdery.com/merch AND PURCHANDISE SOME MERCHANDISE!!!*** / #outroreel

Sportos Háromharmadot hozott ma össze Bita Dániel, Pető Péter, valamint Nagy József. Először arról esett szó, hogy: a kormány napi tízezer darabot vesz az évek óta zuhanó példányszámú Nemzeti Sportból, majd ingyen osztja szét a lapot sportegyesületeknek és közintézményeknek. Másodszor arról, hogy: a köztévét beelőzve az RTL szerezte meg a BL-meccsek közvetítési jogát. Harmadszor arról, hogy: visszatér a politikába a lólengés 1988-as olimpiai bajnoka, Győr volt polgármestere, a jachtos szexvideójába belebukott Borkai Zsolt. Plusz téma volt még Silvio Berlusconi halála és a Libri-Bookline fideszes felvásárlása.

This week Jeremy and Reid are fairly out of sorts and sorts are fairly out of Reid and Jeremy. Topics include the highly emotional conclusion of "Jury Duty" and the dramatic beginning of "Dead Ringers". Bolth available on Amazon Prime. Prime is nailing it; WHO KNEW?! Dead Ringers with Rachel Weisz Dead Ringers (1988) with Jeremy Irons Join Us on Patreon⁠ for the 1hr and 20 min review of Bob Fosse's Dancin'⁠ Nowhere Apparent.⁠  ← Watch it at ALLARTS.org Dancin'. ←← On Broadway!  ◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠ ⁠➩ WEBSITE⁠ ◦ ⁠YOUTUBE ⁠◦⁠ ⁠⁠INSTAGRAM⁠⁠ ⁠ ⁠➩ SUPPORT W/$.99⁠ ◦ ⁠PATREON⁠ ◦ ⁠THE MERCH⁠ ⁠➩ REID⁠ ◦ ⁠JEREMY⁠ ◦ ⁠JACK⁠ ◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠ ⁠➩ withdanceandstuff@gmail.com⁠ ◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠◠

With the exception of a few notable anomalies in metal history, a band's second (i.e., follow-up) album is almost always more ambitious (and usually a ginormous quantum leap forward) than their debut album in nearly every way imaginable. And because we can't help but “poke the bear” every now and again, we thought “Why not pick two of the most incredibly important follow-up albums in thrash metal history to duke it out in the coliseum?”    From 1984, it's METALLICA with RIDE THE LIGHTNING.  From 1986, it's MEGADETH with PEACE SELLS…BUT WHO'S BUYING?  And just to complexicate this confusing conundrum even further: only one of the members of one of these bands has actually been in BOLTH bands AND has songwriting credits on BOLTH albums.  (“To be fair”, ‘tis certainly a vexing quandary to say the least.)   Get ready to “work out your traps and use your sports words” because with these two beasts in the ring doing battle, it's bound to get intense.  Time to “sacrifice some fruit loops” as things get “downright biblical” in the world of classic metal as we pit two of the finest sophomore albums in thrash metal history by two of the finest bands in thrash metal history (who actually share thrash metal history together) against each other!  Prepare to discover the most sensually appealing culinary wonder ever documented in the annals of breakfast food debauchery and JOIN US as we go head-to-head, Death Match style, with METALLICA's 1984 release RIDE THE LIGHTNING vs MEGADETH'S 1986 release PEACE SELLS…BUT WHO'S BUYING?    Visit www.metalnerdery.com/podcast for more on this episode Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter Email: metalnerdery@gmail.com Can't be LOUD Enough Playlist on Spotify Metal Nerdery Munchies on YouTube @metalnerderypodcast   CHECK OUT METALLICA AND MEGADETH ON THE INTERWEBS https://www.metallica.com/ https://megadeth.com/   Show Notes: (00:01): “With something in her mouth…” / “Are they like the #blackalbum of #modernmetal?” /  Find out who the Poison of modern metal is… / ***WARNING #listenerdiscretionisadvised***/ ***WELCOME BACK TO THE METAL NERDERY PODCAST FROM THE WARM CONFINES OF THE BUNKERPOON!!!*** #bonerASMR / #buttonbone / “That's why he's the producer and we are not…” / “He's really the only funny guy…” / #cheers #thisepisodesclinkyoftheepisode #FireOnTheMountain / Another #bunkerpoonguesthostepisode #radiopipes / “Ass up?” / A fantastic #footballchampionshipjoke / “I work out my traps and I use sports words…” / “If you've heard one you've heard enough…”   (05:31): “Megaman?” / #thisepisodesbeeroftheepisode #ClownShoesBeer #SpaceCake #doubleindiapaleale #ninepercentabv / And now, a label reading by #DrEviler / #buttonrubASMR (“It almost sounds like it's talkin'…”) / “That's a loud beer…that tastes like Willie Nelson's weed…” / WE'LL PLAY YOUR SHIT-TAH!!! #PastTheFall (Thanks Will!) / “You don't pronounce it that way?” / “UK or USA?” / #killeropener DRAINER / “Grab one more…” / “If she's alive or latex…” / POISON MIRRORS (#KingDiamond meets #SerjTankian meets #PeterSteele) / “Might as well…” / The angry pterodactyl sound of old school thrash vocals.  / #init #yeah “It's always going south…” / The #EVH of #GuitarHero / MAURICE (this is still #PastTheFall) Definitely some prog influence…very technical. / “Thank you, Boris…” / “Doomy, proggy, thrashy…” (Doobieish?) / “Food porn is #myfavoriteporn” / WHAT!? That sounds delicious! / #shoutout to #breakfastporn at #Hardees / “I'm on the site now…” / “It sounds disgusting?” / “I'll have a note ready…” / If you listen carefully enough, your arteries will harden just by listening to this segment… / “And it's not small…” / #markallthetime / A personal #HardeesBreakfastExperience / “I like small ones…” / #sausagegravyASMR   (27:43): “You actually do the jingle for this kind of episode…” #TheDocket/ HEAD TO HEAD DEATH MATCH: METALLICA'S “RIDE THE LIGHTNING” VS MEGADETH'S “PEACE SELLS…BUT WHO'S BUYING? / / ***You can email us at metalnerdery@gmail.com or LEAVE US A VOICEMAIL at 980-666-8182!!!*** / Quick overview… #Metallica vs #Megadeth #secondalbumASMR / “It's the pre-Puppets Puppets…” / Album cover comparison / “Here's a question…wouldn't it be cool…?” / “Is it a lightning dildo?” / “Which had the better killer opener?”/ FIGHT FIRE WITH FIRE #softintro / “He's got the fastest wrist in metal…” / “You took the words right out of my mouth…” / WAKE UP DEAD #fallingdownthestairsASMR / “'86 vs '84…” / “Just be loose…” / #lightandshadeASMR / A brief note regarding the #MetalNerderyPodcast #MetallicaConspiracyTheory / RIDE THE LIGHTNING (You can almost hear the Mustaine riffs if you listen very carefully) / #TwixConspiracy   (44:15): THE CONJURING (“This sounds very dark…”) / “Right there…that's where this song wins.” / “Like Tom Sawyer meets Free Bird?” / “Headphones make a big difference…” / Track 3:  It's bass to bass… #industrystandard FOR WHOM THE BELL TOLLS (see also Fairies Wear Boots) / Finger or pick? #whaddyamean PEACE SELLS / “If you had to pick…” / “Which one are you gonna hear on 96 rock during the daytime?” / “When I say it there's nips involved…” / “You live alone…” / FADE TO BLACK #trackfourenergy #timelessriffs / “It's sad but it's beautiful…” / #guitarharmoniesASMR / DEVIL'S ISLAND #straightupthrash / “You're a #deepcuts guy?” / At least now we have a working definition of what constitutes a “deep cut”   (1:08:38): Side 2 #killeropener TRAPPED UNDER ICE (and perhaps a new #HTeamConspiracy) / “That's why I don't do it for ya…” / GOOD MOURNING/BLACK FRIDAY (the essence of creepy) / “This one wins…” / Structured vs not so structured / “One of the best thrash songs ever…” / #hoccersockey / ESCAPE (“Dude, that's totally 96 rock in the daytime…”)  #earlyvictorymetal / Ways NOT to mix an album… / BAD OMEN (“It's already creepier…”) / “Sacrifice some fruit loops…” / “No, it's right here…” / No comparison…and also no contest (1:23:05): “This next one wins the entire competition…” / #tobefair CREEPING DEATH (“Iommi smiles every time that riff is played…”) / “50 thousand people at one time screaming…” / “That's fucking #Biblical…” / “Stevie Ray Wonder?” / I AIN'T SUPERSTITIOUS (“It's not even fair to compare the two songs…” / Potential tracking changes to make the comparisons more fair / THE CALL OF KTULU #creepyintro / “Hey Alex WTF is that noise!?” / Comparison of the intro riff from The Call of Ktulu vs Hangar 18 / MY LAST WORDS (“So he's used it more than once?”) / “Listen to me, hold on, STFU…”/ #conspiracyASMR / Now it's decision time…which album wins? / Totally ruined that last analogy using #sportswords / “Those first 3 #Metallica albums are like the first 6 #BlackSabbath albums” / Shoutout to #SterlingMoody / “Do you guys have any merch?” ***COME VISIT THE #BUNKERPOONGIFTSHOPPE at metalnerdery.com/merch TO PURCHANDISE SOME MERCHANDISE!!!*** / THANKS AGAIN TO EDDIE FOR JOINING US AND TO ALL OF YOU FOR JOINING US!!! / #thelastword #outroreel

Soundcloud / 1001 Tracklists / Beatport Chart / Apple Music / Deezer / Cast Box / Player FM / Stitcher / Tunein / AudioMack / Pocket Cast link : https://fanlink.to/kelltic-mainstage-052 00:00:00 - 01. Bolth, Jae Walters - Sacrifice 00:03:54 - 02. GUZ & Camden Cox - Pouring Rain [ Insomniac Records ] 00:08:52 - 03. Huvagen - Forever [ Interplay ] 00:14:05 - 04. Heynegaard & Martin Eriksson - Out Of My Head [ Hysteria ] 00:17:28 - 05. Marco Nobel, Glass Keys, Tyler James Bellinger - The Fire [ Soave ] 00:20:18 - 06. D'Amico & Valax, Fenox, Vicki Linden - Burning Me [ Loudkult ] 00:23:22 - 07. Melsen & Amanda Wilson - Every Single Time [ Be Yourself Music ] 00:26:10 - 08. METANO, RUSH & CRUSH FT. RICHIE LOOP - BEAST 00:29:17 - 09. Costa Music feat. Shaiel - I Still Remember [ Sirup Music ] 00:32:58 - 10. KLAAS & Michael Roman - Into the Groove [ igroovemusic ] 00:35:36 - 11. Turned Around ft. JUME - Waiting [ Chill Planet ] 00:38:46 - 12. Frozen Mindz & Joe Alderson - Mansion [ Backlit ] 00:41:53 - 13. Marteneez ft. Asicnar - Hold Me Forever [ CDR ] 00:46:15 - 14. Meikle, Severman & Anthony Meyer - Wild One [ Intensity Recordings ] 00:50:08 - 15. Lady Gaga - Bloody Mary ( DAVID WHITE Festival Mix ) [ CDR ] 00:52:09 - 16. Fablers & Carlo Ratto feat. Guiti - Let You Go [ TurnItUp Muzik ] 00:55:26 - 17. NORII & dejinosuke - Shine [ BODYWRMR ] 00:57:40 - 18. Alexander Popov & LTN - Formula [ Interplay ] 01:00:22 - 19. C.YANG.S, Ayan (CN) - Reunion [ Dragon Records ] 01:03:53 - 20. GOG (CN), Jones (CN) - Take the World [ Dragon Records ] Promo list email : paddy.kelly@reduxrecordings.com Connect with Paddy Kelly: Facebook: https://www.facebook.com/paddykelly2018 Instagram: https://www.instagram.com/paddykellykkr Soundcloud: https://soundcloud.com/paddykellykkr Stitcher : https://www.stitcher.com/podcast/paddy-kelly-mixes 1001 Tracklists : https://www.1001tracklists.com/user/paddykellykkr/index.html Apple Music : https://podcasts.apple.com/gb/podcast/paddy-kelly-mixes/id1483849229 Deezer :https://www.deezer.com/en/show/606752 Castbox :https://castbox.fm/channel/Paddy-Kelly-Mixes-id2422115?country=gb Tunein : https://tunein.com/podcasts/Music-Podcasts/Paddy-Kelly-Mixes-p1315050/ Player FM : https://player.fm/series/paddy-kelly-mixes Pocket Cast : https://pca.st/ltwdakdx AudioMack :https://audiomack.com/artist/paddy-kelly-kkr

Soundcloud / 1001 Tracklists / Beatport Chart / Apple Music / Deezer / Cast Box / Player FM / Stitcher / Tunein / AudioMack / Pocket Cast link : https://fanlink.to/kelltic-mainstage-031 00:00:00 - 01. Carola & Dynamick - Time Away [ Armada ] 00:03:02 - 02. Bolth & SARRIA - Body Free [ Gemstone Records ] 00:06:05 - 03. HUGO - Be Alright [ Another Rhythm ] 00:09:31 - 04. Amy Lauren, Hako & Jessica Alice - Running with the Devil [ High Definition ] 00:13:50 - 05. Lena Leon - Spiral [ Liftoff Recordings ] 00:16:38 - 06. Jay Hardway - Out Of My Mind [ Future House Music ] 00:19:52 - 07. Joel Corry & Becky Hill - HISTORY [ Atlantic ] 00:23:25 - 08. Julian Kid & Karmina Dai - Tug Of War [ HouseU ] 00:27:12 - 09. Jessie Ware - Free Yourself ( Paul Woolford Mix ) [ EMI ] 00:32:45 - 10. ay-Mill - That's Life [ TurnItUp Muzik ] 00:35:16 - 11. JES - All Or Nothing [ Magik Muzik ] 00:40:11 - 12. Roc Dubloc x Idle Days - One In A Million [ Protocol Recordings ] 00:43:52 - 13. Kris Kiss & Eddy Black - The Night Before [ Ensis Records ] 00:46:52 - 14. Joel Fletcher feat. Ivan Ooze - Flutech [ Spinnin ] 00:50:05 - 15. Robin Aristo - Body 2 Spirit [ Bounce & Bass ] 00:52:27 - 16. Dastic - Way Back Home ( Ryos Remix ) [ Revealed Recordings ] 00:55:25 - 17. WildVibes x Monroe - Wild Wild West [ TurnItUp Muzik ] 00:58:48 - 18. Josh Le Tissier feat. JOST - On My Mind [ Glow ] 01:02:22 - 19. Aly & Fila and JES - Sunrise ( Rank 1 Remix ) [ Armind ] 01:05:49 - 20. Leo Reyes - The Music [ ASOT ] Promo list email : paddy.kelly@reduxrecordings.com Connect with Paddy Kelly: Facebook: https://www.facebook.com/paddykelly2018 Instagram: https://www.instagram.com/paddykellykkr Soundcloud: https://soundcloud.com/paddykellykkr Stitcher : https://www.stitcher.com/podcast/paddy-kelly-mixes 1001 Tracklists : https://www.1001tracklists.com/user/paddykellykkr/index.html Apple Music : https://podcasts.apple.com/gb/podcast/paddy-kelly-mixes/id1483849229 Deezer :https://www.deezer.com/en/show/606752 Castbox :https://castbox.fm/channel/Paddy-Kelly-Mixes-id2422115?country=gb Tunein : https://tunein.com/podcasts/Music-Podcasts/Paddy-Kelly-Mixes-p1315050/ Player FM : https://player.fm/series/paddy-kelly-mixes Pocket Cast : https://pca.st/ltwdakdx AudioMack :https://audiomack.com/artist/paddy-kelly-kkr

As of this episode, it's the last day of the first half of 2022, and there's a veritable plethora of NEW METAL that's either already been unleashed OR is scheduled to be unleashed during the second half of 2022. There's metal we're not as familiar with, metal we've been eagerly anticipating, metal we'd almost forgotten about, there's even some incredibly “titillating” metal.   For this episode, we decided to “take the weekend off” and try something NEW. Get ready to understand the consequences of “going full Beavis” and accept the reality that a good “meat and three” is often just as powerful as an unintentional “Black Album reference” when you JOIN US for a look at some brand-spank metal that's NEW FOR ‘22!!!   Visit www.metalnerdery.com/podcast for more on this episode Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter Email: metalnerdery@gmail.com Can't be LOUD Enough Playlist on Spotify Metal Nerdery Munchies on YouTube: https://www.youtube.com/channel/UCN2NrnCuSrAaLcIzI2wpaiQ    Show Notes: (00:01):  #GetTheFlapsOut #uncorking #nowwereready / WELCOME BACK TO THE METAL NERDERY PODCAST!!! / 33rd Floor Inverted Underground Bunker Poon Tri-County Metropolitan Entertainment Complex / #thisepisodesclinkyoftheepisode #verynice #DeadMansFingersSpicedRum #DMF ***Cornish Soul*** #ThanksDoro  / #segue #thisepisodesbeeroftheepisode / #buffalonewyork #thinmanbrewery #minkydoodle #sweet #dontletherpicknexttime #itsquitetart #sevenpercentabv / #cousin / A “Papa Jacks” story (and a lesson on #patience) / #southernfood #notcomplicated #howyallduhrn #fooddixie / #RussellsReflections #nodeadlines #disrespect / #anger ***For the #bacon consumers:  is there ANY other way to cook it other than #crispy and #welldone?*** / #markthetime / #Recommended #patronage (*Sounds delicious!!!*) #bigportions #point ***Why the HUGE “gap”!?*** #meatandthree #newsexposition / #Suburban #BruOysterBar ***A special #postshowedition of #RussellsReflections and #bassplayingprinciples*** / Different boots, galoshes and flops… / #Shoutout to #DancingSkullsATL #excellentroom #responsivecrowds #awesomecrowds / “The “other” #philia” / #iphiliu / #nobodywantstogofirst #unbearabletension #theperfectcomedicsetup #uncomfortablecreateshilarity #pointpounder / ***GO TO #SWEETWATER LIVE IN DULUTH, GA ON SATURDAY JULY 2ND  IF YOU'RE IN THE TRI-COUNTY AREA AND WANT TO COME ROCK YOUR BALLS OFF with #StonedHenge!!!*** / *** Remembering the original smoking ban back in 2005 and the #economicdevastation    (13:50):  #clammy ***NO WE'LL PLAY YOUR SHIT-AH” this week!!!*** #backupjingle #takingtheweekendoff #imnotgonnadoit / ***Listen to this:  go check it out on #YouTube its #JimCarrey talking about #thrashmetal and the other video that's synched up with #Pantera and #TheGreatSouthernTrendkill #itsexcellent #yourewelcome #hilarious #hahahaha #earlydeathmetalcomedy #JimPanterrysTrendkill #yeah #LMAO #tgstk #thegreatsoutherntrendkill #Pantera #fuckingawesome  ***GO TO OUR FACEBOOK PAGE, FOLLOW US  AND CHECK IT OUT!!!*** / GIVE US A CALL AND LEAVE US A VOICEMAIL at 980-666-8182 #yeah #whyyougottascream #thecheapseats #antarctica    (18:18):  Time to discuss some NEW Metal (as in recent, as in the '22:  #NewFor2022):  Buying CD's NOW is like buying vinyl in the 90's…it's weirdly out of time. / CD's & LP's and #artwork / Inflation vs hyperinflation and #thepriceofvinyl / Reflecting back to cheap gas… / #noteven #inflationhasnocorrelation #newmegadeth #wellbeback #thesickthedyingandthedead #oldschool #oldschoolMegaDeth #VicRattleHeadOriginStory #Megadeth Chapter 1:  WE'LL BE BACK ***GO CHECK OUT THE #YOUTUBEVIDEO for WE'LL BE BACK!!!*** #nextlevelRIP #HailToKiko #LookingForward #FuckCancer and some #hollerin from #UncleDave!!! #DaveMustaineForPresident    (24:24):  New #OzzyOsbourne:  The video version for PATIENT NUMBER 9 (w/ Jeff Beck on lead guitar, Zakk Wylde on rhythm guitar) #coolgraphics #adifferentkindofOzzy #popitup #thecount #JeffBeck /  #Sabaton:  Wait, what? #Weirdsoftintro SAREJEVO #softintroASMR #VikingVictoryMetal #PowerMetal #TriumphMetal #TransSiberianOrchestraASMR #justaddlights STORMTROOPER (#scrotum) #vikingmetal #VikingVictoryPowerMetal #imagery #new #KoRn #Requiem #hiatus #wow THE WORST IS ON ITS WAY / #thehitsingle #psychedelicMeshuggah #greatgroove #deftonesplusmeshugguah #balls   (33:55):  #Corpsegrinder ACID VAT #killeropener #respecttheneck / #Queensryche #titilated #fullnipbone IN EXTREMIS (check out the new, #unabridged version of the #ScreamFromTheBalls #audiobook) / #MunicipalWaste #onmicburp HIGH SPEED STEEL #TheRedFangOfThrash #oldschoolmetal #MachineHead UNHALLOWED (*Go check out our Machine Head episode*)   (44:27):  #LornaShore #itsthatkindofmusic INTO THE EARTH #wtf #hfs #deathcore / #AleStorm SEVENTH RUM OF A SEVENTH RUM #victorypiratemetal / #Adema VIOLENT PRINCIPLES #KoRnIsH / #Stryper RISE TO THE CALL #salvationcore / #GregPuciato NO MORE LIVES TO GO / #AliceInChains vs #Soundgarden / The origin of #Bolth and #MetalNerderyTrivia / #ArchEnemy HANDSHAKE WITH HELL #shredfordays and a completely #tangentional #BlackAlbumReference #AugustTwelfth #ihadtodoit    (58:44):  #PrayingMantis CRY FOR THE NATIONS #killeropener #progmetal #powerprogmetal #powermetal / #Scorpions PEACEMAKER / #Kreator HATE UBER ALLES #FullBeavis #YESYESYES #titlaytrack / #Voivod SYNCHRO ANARCHY (Definitely not confined to a “single box”) / #Behemoth OV MY HERCULEAN EXILE #thefirstsingle / THANK YOU FOR JOINING US FOR METAL THAT IS #NEWMETALFOR2022 / #thelastword #untilthenext #andgoodnight #outromix #hehahuh   

club house / tech house / 124 bpm / 04:00 - 05:00 01 Andrey Exx & Thomas Sun - Other Side (Original Mix) 02 Redford (NL) - Dont You Let Nobody (Extended Mix) 03 Kevin Andrews, We Ourselves & Us - It Takes 2 (Original Mix) 04 Crazibiza - Nasty (Cheesecake Boys Remix) 05 Galantis, Becky Hill, Mele - Run (Melé Remix) 06 Nik Denton - Haus Rocker (Original Mix) 07 Gianluca Vacchi, Alterboy, Thorn - Cucaracha (Extended Mix) 08 Lovra Hugel - Madonna (Extended Mix) 09 Seatbelts - Tank! (Steve Aoki Remix) 10 Cactushead & Dorian Wood - Want You to Know (Block & Crown Remix) 11 Secret Agenda - Rushing (Remix) (Stereotype Remix) 12 Mayami - Dont Kill My Vibe (Qubiko Remix) 13 Bolth, Real Topeka People - Knock Knock (Extended Mix) 14 Drop The Cheese, Juicy M - Dale (Extended Mix) 15 Kevin Andrews, Flaunt-It - The House Of House (Original Mix) 16 Block & Crown, Maickel Telussa - Jump To That (Original Mix) 17 The Collective - Back To Me (Original Mix) 18 David Guetta - The World is Mine (Öwnboss & Moonphazes Remix)

Soundcloud / 1001 Tracklists / Beatport Chart / Apple Music / Deezer / Cast Box / Player FM / Stitcher / Tunein / AudioMack / Pocket Cast link : https://fanlink.to/kelltic-mainstage-may-2022 00:00:00 - 01. Armin van Buuren & Florentin feat. Jordan Grace - Echoes [ Armind ] 00:05:09 - 02. Bolth & Real Topeka People - Knock Knock [ Gemstone Records ] 00:09:03 - 03. LØRD - Afterlife [ Gemstone Records ] 00:13:40 - 04. Alle Farben & HUGEL feat. FAST BOY - Castle ( Maurice Lessing Remix ) [ Warner Music ] 00:17:30 - 05. Andrew Rayel feat. Sam Gray - Wild Feelings [ Armada ] 00:20:34 - 06. Avian Grays - Better Off [ Armada ] 00:23:22 - 07. FAULHABER & Lukas Vane - Push It [ Protocol Recordings ] 00:26:17 - 08. Vintage Culture & Goodboys - This Feeling [ Insomniac Records ] 00:29:43 - 09. Tiesto & Deorro - Savage [ Musical Freedom ] 00:32:59 - 10. Joel Corry x David Guetta x Bryson Tiller - What Would You Do ( David Guetta Festival Remix ) [ Atlantic ] 00:35:35 - 11. Steve James & Morgan Page feat. Brooke Tomlinson - Like I Do ( Chester Young Remix ) [ Armada ] 00:38:53 - 12. Manse, Jac & Harri feat. Amanda Collis - Nobody [ Revealed Recordings ] 00:42:19 - 13. Severman - Lost Diamond [ Backlit Music ] 00:45:37 - 14. Jarod Glawe x Sixth Sense ft. Alex Jones - Fall Apart [ TurnItUp Muzik ] 00:49:12 - 15. Trevor Omoto - Never Let Me Go [ Revealed Radar ] 00:52:26 - 16. AProject - Dreamers Never Sleep [ House District ] 00:55:57 - 17. Dash Berlin ft. Emma Hewitt - Waiting ( Festival edit ) [ North Sea ] 01:00:50 - 18. tyDi & JES - Just Believe ( Darude remix ) [ Magik Muzik ] 01:05:15 - 19. Lost Witness - Happiness Happening ( Rub!k Remix ) [ Armada Captivating ] 01:08:39 - 20. Boris Foong & Cari - Just A Call Away [ Interplay ] Promo list email : paddy.kelly@reduxrecordings.com Connect with Paddy Kelly: Facebook: https://www.facebook.com/paddykelly2018 Instagram: https://www.instagram.com/paddykellykkr Soundcloud: https://soundcloud.com/paddykellykkr Stitcher : https://www.stitcher.com/podcast/paddy-kelly-mixes 1001 Tracklists : https://www.1001tracklists.com/user/paddykellykkr/index.html Apple Music : https://podcasts.apple.com/gb/podcast/paddy-kelly-mixes/id1483849229 Deezer :https://www.deezer.com/en/show/606752 Castbox :https://castbox.fm/channel/Paddy-Kelly-Mixes-id2422115?country=gb Tunein : https://tunein.com/podcasts/Music-Podcasts/Paddy-Kelly-Mixes-p1315050/ Player FM : https://player.fm/series/paddy-kelly-mixes Pocket Cast : https://pca.st/ltwdakdx AudioMack :https://audiomack.com/artist/paddy-kelly-kkr

tech house; club house / 124bpm / 01:00 - 02:00 prime-time 31 Joel Corry feat. Mabel - I Wish (Extended VIP Mix) 32 Diseptix - Dont Phunk With My Heart (Extended Mix) 33 Armin Van Buuren & The Stickmen Project - No Fun (Extended Mix) 34 Carlprit x Onary - Go Harder (Extended) 35 Joey Valence ft. Brae - Underground Sound (Tony Romera Remix) 36 Snakehips x Tchami - Tonight (Extended Mix) 37 VLTRA (IT) - Bananza (Belly Dancer) (Original Mix) 38 Snakehips - All Over U 39 Seatbelts - Tank! (Steve Aoki Remix) 40 Mayami - Dont Kill My Vibe (Qubiko Remix) 41 Block & Crown, Atilla Cetin - We Are Rollin (Original Mix) 42 Mantrastic & Rechler - Spread Love (Extended Mix) 43 Dada Life - Love Is Coming Down (KYANU Remix) 44 Block & Crown - Hit the Drum (Original Mix) 45 Bolth, Real Topeka People - Knock Knock (Extended Mix) 46 DJ Alexis Freites - Lambada Tech (Original Mix) 47 Wiwek & Watch The Duck - Curious (Chocolate Puma Remix) 48 Sandgino, EternalSub - Andaluzia (Original Mix) 49 PBH & JACK, Sash Sings - Jealousy (Intro Dirty) 50 Mercer - Aretha (Extended Mix)

Soundcloud / 1001 Tracklists / Beatport Chart / Apple Music / Deezer / Cast Box / Player FM / Stitcher / Tunein / AudioMack / Pocket Cast link : https://fanlink.to/kelltic-mainstage-014 00:00:00 - 01. Vessbroz - We are the people [ Hexagon ] 00:04:24 - 02. Gab Hydes ft. Rory Hope - Breathe [ Chill Your Mind ] 00:07:48 - 03. Bolth & Real Topeka People - Knock Knock [ Gemstone Records ] 00:11:45 - 04. Sonny Bass & Repiet - Never Mine [ Future House Music ] 00:14:42 - 05. Mahalo & Milkwish feat. Lena Leon - Careless ( Sol Echo Remix ) [ Armada ] 00:18:28 - 06. Different Stage, D-LAUD & Italo Rodrigues - Pararam Pra Reparar [ CDR ] 00:21:20 - 07. Cheyenne Giles - Games [ Armada ] 00:25:08 - 08. Anthony Pears - I Want U [ NoFace Records ] 00:28:08 - 09. Parnassvs - Signals [ Sora Music ] 00:31:32 - 10. Hardware Engineer - Fly Apart [ Dragon Records ] 00:35:31 - 11. ATREOUS & K3WRO & XanTz - We Are Legends [ House District ] 00:39:02 - 12. Jeffrey Sutorius - Apart Together [ Revealed Recordings ] 00:42:37 - 13. Trevor Omoto - Never Let Me Go [ Revealed Radar ] 00:46:06 - 14. Jeffrey Sutorius feat. Jonathan Mendelsohn - Dancing With Tears In My Eyes [ Revealed Recordings ] 00:49:10 - 15. Dash Berlin ft. Emma Hewitt - Waiting ( Festival Edit ) [ North Sea ] 00:54:02 - 16. Boris Foong & Cari - Just A Call Away [ Interplay Records ] 00:57:55 - 17. Lost Witness - Happiness Happening ( Rub!k Remix ) [ Armada Captivating ] 01:02:14 - 18. U-Jeen - Altair [ Suanda Base ] 01:04:45 - 19. Ben Gold & Benjamin Duchenne - Take Me Away [ Armada Captivating ] 01:08:57 - 20. Roman Messer & Cari - Silence [ Suanda Music ] Promo list email : paddy.kelly@reduxrecordings.com Connect with Paddy Kelly: Facebook: https://www.facebook.com/paddykelly2018 Instagram: https://www.instagram.com/paddykellykkr Soundcloud: https://soundcloud.com/paddykellykkr Stitcher : https://www.stitcher.com/podcast/paddy-kelly-mixes 1001 Tracklists : https://www.1001tracklists.com/user/paddykellykkr/index.html Apple Music : https://podcasts.apple.com/gb/podcast/paddy-kelly-mixes/id1483849229 Deezer :https://www.deezer.com/en/show/606752 Castbox :https://castbox.fm/channel/Paddy-Kelly-Mixes-id2422115?country=gb Tunein : https://tunein.com/podcasts/Music-Podcasts/Paddy-Kelly-Mixes-p1315050/ Player FM : https://player.fm/series/paddy-kelly-mixes Pocket Cast : https://pca.st/ltwdakdx AudioMack :https://audiomack.com/artist/paddy-kelly-kkr

Charleston carriage guide from Sweden. “Both” vs “Bolth.” Backstabbing SOB.   Learn more about your ad-choices at https://www.iheartpodcastnetwork.com

In traffic, LEFT TURNS are often far more dangerous than right turns, often resulting in far more accidents that sadly, many never fully recover from. Somehow, the same rule holds true in Metal* (and potentially, even this podcast!) as well:  some LEFT TURNS are legendary. But as is (sadly) far too often the case…many LEFT TURNS, not so much. Prepare for a lot of “marking the time”, find out who “smelled like a peach”, brace yourselves for some moments of “being up cool” tangentionalality* that are barely hanging on by a wispy string of sameness snot and JOIN US “up against the rail” in a “dry diaper” as we touch on BOLTH the recent Atlanta Metallica tour stop and some extremely notable (and legendary) LEFT TURNS in Metal.*   *Metal is tangentional to everything and everything is tangentional to metal. Don't worry about it.   Visit www.metalnerdery.com/podcast for more on this episode Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter Email: metalnerdery@gmail.com Can't be LOUD Enough Playlist on Spotify Show Notes: (00:01):  #dontfuckwithtradition #thatsthesound of a #highfiberasshole #waitwhat #assjealousy #waterbutt and #opera #ilovethehelmet #Pavoratti #MarkTheTime (and a viable, #scientific #theory yet to be #disproven regarding #moderndaybutthole #farttechnology using #balloons as an #analogy) #lettuce #dothis / ***WELCOME BACK, 100%!!!*** #zerobullshit #zerototalcomplete and also #bolth #complete #onehundredpercent #bullshit #hail to #fireonthemountain #toomanydetailsASMR #insertitlater /#prematureculmulation ***DON'T FUCK UP THE ROTATION!!!*** #maskshadowing and/or #backshadowingASMR #maskshadowingASMR #markthetime #premature #culmulation #outoforder (sorry, take 2 guys, okay, take 2…a #leftturn) /#maskshadowing or #backshadowing #thirstythursday #introshot #clean #myhonk #smelledlikeapeach “Settle down Beavis. #rewind” / #waitwait #fuckingdamn #backup #rewind #backmasking #backmaskingshadowing / #thisepisodesbeeroftheepisode #supportlocal #oohyeahhh #mondaynightbrewing #atlanta #georgia #popthattop #doctorrobot #drrobot #souriscorrect #markthetime #blackberrylemonsour #fivepointzeroabv #gratitude #bolth #notyetfruited #markthetime #uberpucker #markthetime #bolthways #tart #refreshing #fruited #tartglands #markthetime (***#WTF is up with the #albumcover!?***) #robots and #fruit #trexarms #dangerwillrobinson #STFU / #tart I think he means like #LandOfTheLost or #DangerWillRobinson) / ***Leave us a #voicemail at 980-666-8182!!!***/ #weheartrelaxers #wereallyheartcomplimentaryrelaxers (06:43):  #hetoldtusbolth #hetoldtus / The Blasting Sessions:  Bolth, and the Left Turns in Metal #leftturnsinmetal / ***working definition of a #LeftTurn in Metal as required for the #context of this episode*** / #whoreable or #horrible or #badass or #redemption or #damnation #andor #bolth #thatwasdeep #markthetime #pancreaticbowelburp #notintermittentfasting #insertcricketshere and #lastnight #hints on #intermittentfasting and Matt's #DietTips #perfectlyrelaxed /***HEAR YE, HEAR YE!!! (that's just to satisfy Russell's eternal ego boner. j/k, bro #lmao #egoboner That's worth #millions #hahahaha) #dimension #otherbetterhalf Recent show feedback regarding the recent #Atlanta #Metallica #show #2021 #menaresimplecreatures #ability and #talent and #tits and #wiles #alsotits / The first time The Russell took the #offspring to see Metallica in #ATL / #itscalled #goahead #dontberidiculous  #upagainsttherail #done #nodiapers #sweatitout #herewego #strandedatthefrontrow #sss #markthetime / Relishing the #primospot at a Metallica show (because why would you not!?) / When you're #committed to #frontrow, you don't get to get beer / #nodiaperneeded #wifetalent #markthetime #sweatpiss #pisssweat #intelligentcreation #crisscrossapplesauce #idonthavekids #hellaoffensive #yogastyle #indianstyle #itiswhatitis / #beervendors and #abundance #beingupcool #markthetime #beingupfront #peace #waybettersound #thewifewenttoseeMetallica #twoshittyopeners (relative to prior shows, also referenced) / #GrettaVanFleet or #GrettaVanFleek or #bolth #alittleweird #ivegottainsertthis #markthetime ***GIVE US A CALL AND LEAVE US A VOICE MAIL AT 980-666-8182!!!*** #outfitchanges #wtf? #howmany? #indie And a few #fun #trivia #facts about #Kentucky  / #CageTheElephant #roamfree #youdknowitifyouheardit #what #airquotes #indieKentuckyCollegeBand NO REST FOR THE WICKED (double up your relaxer regimen, and #prepare for #painfulasshole /  #dialated and #tingly and #vulnerable ) ***wait for Russel's Rationalization Wrap-Up*** #codeforthisisgonnasuck #justplayit #wow #maybealittleharsh ***We're going to HAVE to do a #KISS episode NOW!!!*** #singlefingersalute  (20:34):  #MetalNerderyPodcast is like #psychology for #metalheads and #themetalcommunity #noteven / ***The concept of opening bands for a Metallica tour*** #theresisareason #no #yeah #ohboy #ohgeez #thepartimafraidof #afraid And a moment of super #indeedliness regarding the #perfectopener for #Metallica (and Russell's theory regarding the #roster) / #fanboners (could you imagine seeing #Exodus open AT a Metallica #concert?  That would be #sonicbliss and a #fanfavorite #RussellsRant #theirownheadliner but it would have been killer #exposure and #legendary and a #necessary #historylesson in #metal  #TheBigFiveAmendment and/or more in the #targetmarket i.e. other #upandcoming #thrashbands / #MetallicaHasNoBoss #yeah #andwolfsteakdinnersforall #WrestleMania for #Metal #Yeah / #openyourmind #takewhatever #thinkaboutit / Taking a band out because you LIKE them and are fans vs taking them out because it's strictly a #marketingtour with #zerocommonality / #theyhavenoboss #kings and #ropes #ororor #STFU #fallinline (***recent show memories from the recent Metallica show recently in Georgia***) #ivotedforbrandon and guys holding #ropes and #zeig #PTSD #reversemotivation #longwinded #everyone (***the #punchline to #RussellsLongWindedStoryASMR***) #anyway #thecoolendingtothestorythatnevercomesfromRussell #hahahahaMetallicahumor #thankyouforthat  / #othermotherfuthers # (To see who Russell's #otherhalf is, check out Metallica's #Facebook page!) #MarciasFirstMetallicaShow72ASMR #seventyfivethousand (#forrillz) #smelleddelicious #oooohhhyeahhhh #wolfsteakalert and a moment of #relaxerinfusedmetallogies #themeatoftheleftturnepisodeASMR  #waitforit #thethrashcommunityfamilytree #tangentional (32:18):  LEFT TURNS IN METAL (#beforeandafter-like differences in extremes…keep listening

There was a time when Movie SOUNDTRACKS basically sucked and the only thing that could make them even remotely palatable was the inclusion of a Metal band, really any metal band!  (Obviously NOT Europe!).  Thankfully, we now live in the modern age, where it's not uncommon to see bands like Slayer and Pantera included on a moving picture soundtrack. (And as you'll soon discover, bolth bands have actually been on several soundtracks, and actually on one together!!!) Time to corral your free-range “pre-steak”, find out the answer regarding “Greg's” whereabouts, butter up the relaxer-infused jerky-flavored popcorn and get ready to JOIN US for some fuun, as we indulge in the “sultry sounds of nice” and stroll through the realm of METAL SOUNDTRACKS.    Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Can't be LOUD Enough Playlist on Spotify   Show Notes: (00:01) - #thesultrysoundsofniceASMR #Fuun #holdup #ohfuck / ***WELCOME BACK to the #MetalNerderyMetalverse !!!*** Intros and #pleasantries and #nonesuch #thisepisodes #beeroftheepisode #thisepisodesbeeroftheepisode #thisone #intuitive and #clear #again #PontoonBrewing #AlexOoohOfApproval #thisparticularepisodesbeerofthisepisode #PontoonBrewing (said that earlier…) #slam #CrushingWaves #WhhheatBeer #WhhhhaitWhhhhat? and also a #WheatBeer  #grassyass #mids #beatsbydre #freeplug #yourwelcome ***#albumcover #description in a #nutshell #rhymes with #MetalNerderyHQ33rdFloorInvertedUndergroundBunkerPoonStudios #tartsalivationASMR #notchunky / a #messenge but first a #klinky or a #halfklinky or a #klinkyandahalf (#MetalNerderyMessenge, Pt. 1)   (04:00) – Soundtracks, movies, and Metal (especially when soundtracks had METAL! #MetalNerderyBurpCoreASMR) / #fasttimesatridgemonthigh #MikeDamone #sidetwoofledzeppelinfour #wrongsong and a #tangentional #familyguymoment #breakfastcandles /#mainstreamocity of Metal on a soundtrack used to be #rare…and #treasured / Early #soundtrack #memories (#MaximumOverdrive #ACDC and #WhoMadeWho #originalsoundtrackalbum #overtangentionalled) #theydidscore / Some other #significant #Metal #contributions to #soundtracks including #Slayer #covertunehatred #burpfadeoutASMR #FFS #turnitoffnow / ***Whenever #metal was on a #soundtrack it was cause for #celebration and #rejoicing and also a #verybigdill #waitwhat #ididnteventhinkaboutthehelmet although #ilovethehelmet #contradiction #recordscratch*** A brief trip down the rabbit hole of #metalsoundtracks #metalsoundtrackASMR and #fuun in #Angerland #bigdill #bolth #backintheday   (11:42) - #thetitleytrack #Biohazard and #Onyx JUDGMENT NIGHT #judgmentnight (the #originalmotionpicturesoundtrack for the film Judgment Night) / #justamoment ANOTHER BODY MURDERED #MikePatton and #BooYaaTRIBE #publicenemyesque #minisoundtrackalbumdive / #yougottaplayTheHelmet #Helmet #ilovethehelmet #drillsolo #ting #loveit JUST ANOTHER VICTIM #pitchshiftedtimetravellingtriggery / #Pinche #Slayer and #IceT DISORDER #fuckingSlayer #FuckingSlayerASMR #wedontneedyourwar #thankyouandfuckoff #fuun   (16:34) – Heavy Metal-The Movie (#circa1981) #gambling #preMetal #SammyHagar #titleetrack #uhhyeah #VeryPriest #precomemetal #donaldfagen (***#SteelyDan was the #correctanswer***) / #BlackSabbath THE MOB RULES (“If you listen to fools…”) #BlackSabbathTrumpsEverything  #TonyIommiForPresident (or even also #MattPikeForPresident) #makingupforitintheshownotesASMR #GodBless #MetalManifesto #episode110 / #burpbelchingmaniaASMR / #CannibalCorpse HAMMER SMASHED FACE (from Ace Ventura Pet Detective) #excuseme #isGregHere? #thankyou #AceVenturaPetDetective #nevergetsold #newfoodgenre #spiderconspiracyASMR #spiderpropaganda #uhhhYeahhh   (22:20) – The Crow #thesomething #PanterA ***NOT #the #vadge (#RespectTheBadgina #RespectTheVadge) but also #TheBadge or #TheBadgina*** #thereitis / ***And now, Ladies and Gentlemen, Mr. Tom Morello*** #eembahbahbah #justataste of #jazzyshred #guitarsolo with #flava #TomMorelloGuitarSolo #veryfuckingcool #Moes #TheVoicemailSegment ***GIVE US A CALL AND LEAVE US A VOICEMAIL AT 980-666-8182***/ DARKNESS #RageAgainstTheMachine #RATM #waitforit #fastfingers and #extremelytasteful***Is the #vadge out?  #Pantera covering THE BADGE by #PoisonIdea (still from The Crow #originalmotionpicturesoundtrackalbumrecordingsongcontribution #PanterAized #weight / #ahnold #impression #notreally #heavymetty #vettyheavymetty / #amomentoftirade #regarding #backintheday   (28:42) – A #Revelation from Russell that sounds like it's 40 years old, but it's actually not…and a moment of #tangentionalalityismness to the 90's (see also #DaveJerden #AIC and #Anthrax for related #tangentionalality) #everyonechangedinthe90s / A “cow” equals  #presteak #Gertrude #freeplug from #TheRibLounge from #RonAtTheRibLoungeOfficial #neverseentit #episodederailmentASMR and #math #itswhatido ***metalnerdery@gmail.com #9806668182ASMR #GeoffTaintASMR  / #theoriginalmotionpicturesoundtrackalbumsongtrackthing from #stillFreddyVsJason Freddy Vs Jason and a #verynecessary #tangentional #notthat #ultratangentional #blackalbumreference #twelveyearsafter #blowoutthelines / #sparktical #Sepultura with #MikePatton THE WASTE ***See also #MrBungle…basically, Mike Patton + Any Band = a new version of Mr. Bungle*** #readthoselyrics #heedthoselyrics / To Mike:  #hail and #bewell / #Isolation and a #tangentional reference back to #Sepultura (and #Quadra)    (35:25) – Demon Night (#originalmotionmoviepicturesoundtrackalbumrecordsongcontributionASMR) and #TheMatrix #ThePunisher and the #AlexOoohOfApproval #regarding #Slayer and #Hatebreed and various, lesser mentioned soundtracks and a personal tangentional moment of 90's #alternativemetal and some #tangentional #idonthatepussy #BushHate #overrated #youractingsuckstoobutnotasmuchasyourband  #passiveaggressiveASMR / #inwardburp #notfdaapprovedASMR #HeyManNiceShot / “The Spawn” #originalmovingmotionpicturemusicsoundtracktacticalsongobligation #WaitWho #Dreadful #SimplyDreadfulASMR (***It was #EVH not #MJ***) #Slayer and #AtariTeenageRiot NO REMORSE (I WANNA DIE) #hateitalready #fuckthat   (41:08) - Rivers Edge #RiversEdge #backhanded #itsnotashittymovie #itsgreatbutitsucks #HallowsEve LETHAL TENDENCIES (from the #ATL!!!) #beforetheywerestars #whatsthecrazyguy #mostofthemare #weirdfeeling #WREKage #flashback / #SlayerizeMe with some #Slayer #MCTentacleChoice EVIL HAS NO BOUNDARIES #ifeelbetternow #tingly #itsmarked   (46:33) – The #anonymous #Angerman and the opposite of #fuun is #evil / #ballz #adifferentkindofexcitermoment #andthereitis (***the #actual track was #TrickOrTreat which is a #killeropener***) / #overrelaxered #medicateddemons / Strangeland (the motion picture soundtrack album release thing) #Soulfly EYE FOR AN EYE #grunt #standby for #tentacledifficulties #seewhatIdidthere? / ***PLEASE PAY ATTENTION FOR THIS NEXT PART OF THE SHOW!!!*** #thishalfoftheepisodesthisbeeroftheepisode #thesecondhalfoftheepisodesbeerofthispartoftheepisode #theconclusionbeeroftheepisode #alsoPontoonBrewing WAKE ZONE #pellell see also a #paleale #thatthingisstickingup #WakeZone #markthetime #manbeer #PontoonBrewing #yourewelcome #russellburpASMR #totallyRussell #burnedmyeyesalittle EYE FOR AN EYE #primal #tribal #pribal #trimal #boLth #technicolorformusic see also #chromesthesia   (54:03) – Dracula 2000 (#uhhyeah) #SystemOfADown covering METRO by #Berlin and a #debatablemoment as to whether or not #SOAD would classify as #SkaThrash in terms of #genre and #wishingyoueverysuccess / AVOID THE LIGHT by #PanterA #greatesttits #yesplease #creepysoftintro (not the song but the band…) #Inslomo #lastsecond #wordplay #hahaha #irony #derpyderp See also #ReinventingTheMetal #cantbeloudenough #CBLE #goodone #onmicburpclubdubburpbassASMR   (1:01:50) – The movie from 1985 “Demons” (#notNightRanger #backingup) ***Pretty Maids #PrettyMaids – I mean it ain't no #RickSpringfield but it's close!***  (#pleasantlysurprised) and an #offtopic moment regarding #BillyIdol and that change from hard rock to more of a #metal sound #devilish It's #NOT #NightRanger its NIGHT DANGER #biggamble #areyouscared #talkyburp and #Doro #nicetoseeya #toseeyanice #burn from the #boozemaiden #saywhen #imgoodbabe #thisbetterbegood #itsallonme #redemption #definitelymetal #tentativetentacles NIGHT DANGER by #PrettyMaids and footage from #EvilDead #gropedbygreenery in the #musicvideo (***see also Tree “R-Word” Scene***#iykyk #NotTheTreeRWord #NotTreeR_d  #foliagefondling #treelove #theXword #tentacleovertime   (1:08:30) – From the soundtrack of #MaximumOverdrive and #ACDC DT #instrumental / ***picking back up from the earlier #messenge…#pleasehold… (#MetalNerderyMessenge, Pt. 2) #reallylong #TheMarkOfCain from #Australia is in a potentially similar vein as #TheHelmet.  The song is called:  TELL ME #notlive #sleepyballs #necessary #longintro #quitegood / A various other assortment of other bands and/or soundtracks and also/or #loans and #raingers or #lone #rangers #lonerangers #lonesrangers #bolth #noigetit #noteven #whocaresaboutEnglish #loopholegenre #noderp   (1:14:50) - #TenaciousD “The Pick of Destiny” ^ #ithinkitis #imdefinitelyprettysure KICKAPOO and #futuresteak #yeah***go watch the video…AND go watch the movie! *** #seekthestrawberryriver #jaybels #doublethemetal    (1;19:38) - The Punisher #Slayer #because #FuckingSlayer and #uhhyeahhh THE FINAL SIX ***send someone some #tentaclelove #today*** #notthefinalcountdown #ultraderpASMR #STFU THE FINAL SIX (because maybe you forgot about that part if your #adderall and/or #relaxers isn't and/or aren't working) #SlayerIsABlessing #feelingbetteralready from #boLth #ThePunisherSoundtrack and the #ChristIllusion album. #blessin #ilikeitalot / Perhaps a single volume for a multi-installment series…***THANK YOU FOR LISTENING TO AND SUPPORTING THE METAL NERDERY PODCAST!!!*** / #untilthenext #softoutro #andthereitis #GeezahTheButlah #buyourshit at metalnerdery.com/merch  #outofcontrol #waitWTF #holywhatthefucktitudeBatman #itsallbullshit #theresnomoon #educationalpurposes #thebadgina ^ - We at Metal Nerdery 33rd Floor Inverted Underground Bunker Poon (I.U.B.P.) Studios in the beautiful, lovely, and talented (and shaved) area of downtown Atlanta, Georgia, feel that we would be terribly remiss in our capacity as a Metal-centric podcast if we were to fail to include Tenacious D in the greater metropolitan pantheon of Metal Podcastery.     Also…We're assuming (really kind of praying…) that you can actually read and that you actually take the time to look at this ridiculousness.  We sincerely hope you can read.  If you can, in fact, read, we also hope that you'll help someone else to learn “how to read” and talk good.  If you've read this far, know that we heart you and THANK YOU SO MUCH for your listenership and continued support!!!  #HAIL to #RonnieJamesDio, to #MeatLoaf and to #YOU!!!  

The weekly radio show from Alok. 01. Bhaskar & Tom Enzy - Born To Kill (with Alok)02. Slander - Love Is Gone (Alok Remix)03. Alok & John Legend - In My Mind04. Alok, Alott & Apophis - Alone [PREMIÈRE]05. Kohen & Parah Dice - Bring Me To Life [PREMIÈRE]06. Schutzer feat. Pershard Owens - Be Right [PREMIÈRE]07. Futuristic Polar Bears ft. Franky - No Tears Allowed08. Öwnboss, Bolth feat. Debbiah - Fly Away09. INNA - Hot10. Edward Maya - Stereo Love11. Joel Corry, Jax Jones - OUT OUT12. Hawk, Reznikov & Joey Busse - Here To Say (Na Na Na)13. Selva - Friends (with Robert Falcon)14. Becky Hill & Topic - My Heart Goes15. Shouse - Love Tonight16. Tiësto & Karol G - Don't Be Shy17. Yves V, Dubdogz & ILIRA - Are You Ok18. Jordy - Till It Hurts (Pink Panda Remix)19. Moodshift - All of You20. Volkoder & TRIBBS feat. Reja Jay - Whisky21. Alok & Hollaphonic - Sunglasses At Night

Sentinel - All I Wanna Do [Enhanced Recordings] Ferry Corsten feat. Lovlee - Poison [Armada Music] Öwnboss, Bolth feat. Debbiah - Fly Away [Gemstone Records] Vion Konger - Drama [Crash & Smile] David Deere - Ripple [Big Toys Production] Audien feat. Cate Downey - Wish It Was You [Armada Music] AWAKEND & Sammy Plotkin - Break Through [Enhanced Recordings] Tritonal feat. Cristina Soto - Still With Me (Elevven Remix) [Enhanced Recordings] Muvy & DVBLTVP - Sky3 [Enhanced Progressive] Shapov & Nerak - Heaven [Armada Music] Alex Nocera and Roy Batty - Inner Space [Gemstone Records] Tritonal feat. Meredith Call - Broken Down (John Grand Remix) [Enhanced Recordings] Warung - Sinuous [Enhanced Music] Sound Quelle - Fofan [Colorize] Temujin - Nightsky [Enhanced Progressive]

/ Soundcloud / Hearthis.at / 1001 Tracklists / Beatport Chart / Apple Music / Deezer / Cast Box / Player FM / Stitcher / Tunein / AudioMack / Pocket Cast link : https://fanlink.to/kelltic-prog-049 00:00:00 - 01. Tommy Jayden - System Malfunction [ Future House Music ] 00:03:18 - 02. Julius Beat, Vic Rippa - Ass (R3dub Remix ) [ Dragon Records ] 00:07:23 - 03. Casper Yu, Glasscat - Nothing Good [ Purple Fly ] 00:10:26 - 04. Öwnboss, Bolth feat. Debbiah - Fly Away [ Gemstone ] 00:13:29 - 05. Martin Jordan - Remedy [ Break It Down Music ] 00:16:05 - 06. Mark Roma ft. Lauren Nicole - Need Your Love [ CAOS label ] 00:19:21 - 07. PAX - Cosmic Kiss ( Gorgon City Remix ) [ Factory 93 Records ] 00:23:53 - 08. Axwell ft. Magnus Carlson - Center Of The Universe ( Dave Ruthwell & Mr. Sid Remix ) [ CDR ] 00:27:26 - 09. Laidback Luke & Carta - Kong [ Revealed Recordings ] 00:30:33 - 10. Vargenta & Quando- A Place In My Heart [ Kronos Recordings ] 00:33:37 - 11. KAAZE - Dive [ Revealed Recordings ] 00:36:49 - 12. Tungevaag - Peru ( Tungevaag Remix ) [ Spinnin' Records ] 00:40:26 - 13. Gellero & Roxana - Nobody Watching [ Crash & Smile ] 00:43:18 - 14. Colin Crooks, Philipp & Robbie Rosen - Survivors [ Revealed Radar ] 00:46:52 - 15. Diegx, Alkaz & SweetState feat. Eon Le Roux - The Way Out [ Revealed Radar ] 00:50:29 - 16. Mike Williams & Felix Jaehn ft. Jordan Shaw - Without You ( Mesto Remix ) [ UMG NL ] 00:53:54 - 17. Ryos & Reggio feat. Linney - Battlefield [ Revealed Recordings ] 00:57:22 - 18. Luke Bond feat. Duna Lua - Habitat [ Armind ] 01:02:24 - 19. Milad E & David Deere - Endeavour [ Trance Mission ] 01:06:06 - 20. ZEUS - Eyes On Me [ Interplay Global ] Promo list email : paddy.kelly@reduxrecordings.com Connect with Paddy Kelly: Facebook: https://www.facebook.com/paddykelly2018 Twitter: https://twitter.com/paddykellyKKR Instagram: https://www.instagram.com/paddykellykkr Soundcloud: https://soundcloud.com/paddykellykkr Youtube : https://www.youtube.com/channel/UCgRTRqdVC8er4Xseg3edU1w Stitcher : https://www.stitcher.com/podcast/paddy-kelly-mixes Hearthis.at : https://hearthis.at/saturdaysesh-qh/ 1001 Tracklists : https://www.1001tracklists.com/user/paddykellykkr/index.html Apple Music : https://podcasts.apple.com/gb/podcast/paddy-kelly-mixes/id1483849229 Deezer :https://www.deezer.com/en/show/606752 Castbox :https://castbox.fm/channel/Paddy-Kelly-Mixes-id2422115?country=gb Tunein : https://tunein.com/podcasts/Music-Podcasts/Paddy-Kelly-Mixes-p1315050/ Player FM : https://player.fm/series/paddy-kelly-mixes Pocket Cast : https://pca.st/ltwdakdx AudioMack :https://audiomack.com/artist/paddy-kelly-kkr iHeartRadio : https://www.iheart.com/podcast/269-paddy-kelly-mixes-62216047/

Since analogies are usually the easiest way to explain two things which are similar, think of LED ZEPPELIN as the Metallica of the 60s and 70s…kind of.  As Metallica did with so many obscure NWOBHM bands and songs, similarly, LED ZEPPELIN co-opted the sound of their favorite obscure Blues artists to help forge a new, heavier brand of cockrockian sonic bliss never heard before in Rock'n'roll. Let the “Dogs of Doom” out to play, roll another bowl of Valhalla relaxers to celebrate Ragnarök Eve and JOIN US as we marvel at the legendary proto-metal behemoth comprised of Robert Plant, Jimmy Page, John Paul Jones, and John Bonham and known collectively throughout the pantheon of Rock and Metal as LED ZEPPELIN.   Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Show Notes: (00:01) – #uhhhhh #butumm #askyourdoctor for #samples / #welcomeback to #MetalNerderyThirtyThirdFloorInvertedUndergroundBunkerPoonStudios #notmeth #justregular***This episode's #beeroftheepisode / #HailToStillFire #ooohyeahhh #StillFireBrewing #GloryHaze #Cool #AlbumCover #WaitWhat? #descriptionization #letswrapthisupquickly #explosionofjuiciness***   (03:33) – LED ZEPPELIN…you knew it was coming… #LedZeppelin is the #Metallica of the 70's. #analgeez #ThunderVikingWizardDruids and the “magical combination” of different creative forces coming together (#seealso #coalescing) to make something #special (#dontdenythepowerof #sessionmusicians) (#doowop with #mushrooms #doesanyonerememberlaughter?) / ***What was YOUR first #Zeppelin experience?  (It's hard to pick when every album is uniquely awesome and different). ***   (08:25) - #MentalFloss #lysticle #rockinandrollinfacts - ***GIVE US A CALL AT 980-666-8182 AND LEAVE US A VOICEMAIL!!!*** Lead Zappillian on the #mainstage (#what?) #Idiot and the #originstory behind Led Zeppelin (Lead Blimps) …#ismellsmoke #noteven #blowout #slobthenobs and #therewego / John Paul Jones' “#realname” / #canyouhearme? #diapers / Thirty Hours, a small investment and a #hugepayoff #greatfuckinginvestment #drumrollplease #waitwhat #forreal / #Monster and #Mobster #boLth #GoldenCow / #ALWAYS give credit where credit is due…especially to the #originalartists (Like #WillieDixon et al) and the #conundrum around “borrowing” and/or #plagiarizing other #musicians #riffs. #GoWatchTheSongRemainsTheSameASMR #mystique / #ElectricTheremin #ASMR with Tommy Lee #weirdnessosity / The beginning of #TheOcean and the ringtone in the background #Kramer #Tolkien   (18:10) – #albums vs #singles (Led Zeppelin were an #albumrock band) and #audiobookchapters vs #entireaudiobooks #overrelaxered / #TimeToFrost and #contingencypeeing #TMI #tpissriggeralert #biggerhole / COMMUNICATION BREAKDOWN is #heavymetal and the number of original Led Zeppelin songs vs #coversongs from other artists / Who is the artist formerly known as #traditional? See also #publicdomain / #haters and another #analology / A listing of classic rock bands (including Led Zeppelin) with a blues based #infrastructure (#futureepisoderelaxers) and the impact of those bands on later rock bands and #metal bands / #whatdidiwin? #thatsnotwhatyousaid #markthetime #imrightyourewrong #boLth #mattsrightdotcomhashtagcore    (27:38) – CAROUSELAMBRA (#progressive #goodfrostsong) #deepcuts from #thelastalbum and a changed #lambscape (*it's more kinda like their Sabbath Bloody Sabbath…kinda*/ ACHILLES LAST STAND (#goinginreverse) #HumanResourcesASMR #deeper not #higher and vocal #control (growing & #evolving as a #vocalist) / Knowing your strengths and using them subtly and/or sparingly / #hollowpenos / I CAN'T QUIT YOU BABY (#DaveASMR) and a memories about #LedZeppelin in the #mancave with #Relaxers and #BlackLights and the “ideal way” to watch The Song Remains The Same (The Movie…)   (37:43) – THE SONG REMAINS THE SAME (#boom #imstillright) ***Go watch the #concertmovie #TheSongRemainsTheSame!!!*** (How low do you hang?) #thesnap / The Timeline from the release of Led Zeppelin and Led Zeppelin II and some fave tracks from #LZDos and the #ultimate #autumnsoundtrack #nowronganswers #killercloser #brainstormingmethods #LedZeppelinIIASMR / BRING IT ON HOME #imsorrywhat #watchout #waitforit #magmoovuv #noteven #justthefullness #markthetime #noteventhenewcore / WHAT IS AND WHAT SHOULD NEVER BE (in true #relaxerphonicaudio) bring on the #breakdown #cantbeloudenough #offmicburp / ***What would be in YOUR #70sPlaylist?*** #SomethingAboutThe70sMan #TimeMachineRelaxers and #Crickets (#waiting for #absolutecertainty and #perfection #notbitter #safetyfirst ***GIVE US A CALL AT 980-666-8182 AND LEAVE US A VOICEMAIL!!!***   (48:45) – #notanymore / Led Zeppelin III (#completelydifferent) SINCE I'VE BEEN LOVING YOU is #transcengential and definitely not #folky and some more songs by the artist formerly known as #traditional (Can you hear the squeak?) ***you can find a pic of this moment in time on #thesocials #ididwhaticould / OUT ON THE TILES #nastygroove #thatsmetal and the #allovertheroad guitar sound of Mr. Jimmy Page throughout the catalog / ***If you HAD to pick JUST ONE #DesertIslandAlbum, which one would YOU pick? *** / BLACK COUNTRY WOMAN #context #arewerolling #noteven #itnevergetsoldASMR #thebuild   (59:00) – ***What would be considered #MetalZeppelin? *** And what is Thor's favorite #LedZeppelin #album? *** #thefourthnewalbum / WHEN THE LEVEE BREAKS (#analogyoverdose #myballshurt) and Led Zeppelin's #BackInBlackAlbum BLACK DOG & FOUR STICKS #twentythreetimesplatinum / THE BATTLE OF EVERMORE (#visual) and recalling a #PagePlant show from #backintheday #grower / What's the favorite from Led Zeppelin IV?  #markitdude #thatshard #shoutout to #96Rock #tiedforbolth / The #essence of Led Zeppelin is found in NO QUARTER #letitringout #heyyyymannnn this song is a #marcpotterson favorite and a moment of #tangentionalalityismness regarding an artist's (specifically a vocalist's) evolution over time    (1:16:33) –#noteven to #allinquiries IMMIGRANT SONG #Valhalla #usethoseheadphonesASMR #theshadows #backupvocals #Ragnorak / DAZED AND CONFUSED (and a parting note…#cockrockian #wondertwin and some additional #scrotumballsASMR) ***THANK YOU FOR CONTINUING TO LISTEN TO AND SUPPORT THE METAL NERDERY PODCAST!!!*** (#blowingoutthelines) #stonerASMR #recordscratch #outtakesASMR #morefadeout #itsallbullshit #theresnomoon #okayturnitoffnow  

  #DSR019 Tracklisting   1) Elderbrook & Bob Moses - Inner Light (Original Mix) 2) Jack Wins x ManyFew - Out Of My Head (Extended Mix) 3) Viiq - Heartless (Bexxie Extended Remix) 4) Showtek ft. Theresa Rex - What Is Love (Extended Mix) 5) York - On The Beach (Kryder & JenJammin Sax Remix) 6) Loud Luxury ft. brando - Body (Mo Falk Flip) 7) MALARKEY & Lodgerz - Take Me Higher (Extended Mix) 8) Mastrovita - Back Around (Extended Mix) 9) Vidojean X Oliver Loenn - Found You (Extended Mix) 10) Sonny Fodera, Sinead Harnett, Kolidescopes ft. Sinead Harnett - Nah (Extended Mix) 11)  Öwnboss, Bolth ft. Debbiah - Fly Away (Original Mix) 12) Marc Benjamin & Moonway ft. Chacel - Lovin' You (Extended Mix) 13) Tiësto & KAROL G - Don't Be Shy (Extended Mix) 14) Michael Calfan & HARBER ft. NISHA - Feelings After Dark (VIP Extended Mix) 15) Jay Hayton - All I Can See (Extended Mix) 16) Lastlings - No Time (RÜFÜS DU SOL Remix)   www.darkmada.com

By 1983, MOTLEY CRUE had cemented their legendary reputation as the most notorious heavy metal band on the Los Angeles Sunset Strip.  The band's sophomore release, SHOUT AT THE DEVIL, can be summed up as NWOBHM meets L.A. Glam with a generous infusion of decadence, debauchery and just a dash of the occult for good measure (because let's face it:   if it terrifies the establishment enough to put a “Parental Advisory” sticker on the cover, you know it's GOT to be awesome!).   Listen closely for the squishy sounds in the background and “always remember” to order up some Krell kabobs as you JOIN US for a heroic dose of the sleazy debauchery and hedonistic excesses of “The Caligula of L.A. Metal” as Metal Nerdery salutes the band and the album that made The PMRC Filthy Fifteen and scared the Hell out of parents everywhere!   Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Show Notes: (00:01) – #andbegin Official #Legal #clinky #innertrex #multiverse #onehundred #doyouguysremember #bolth #alwaysremember (***What's a good #flashback #soundtrack???***) ***MOTLEY CRUE:  SHOUT AT THE DEVIL (Where were YOU when you first heard Motley Crue's sophomore slam!?) / A word from Selma Mae / #KidsInSatansService or #KnightsInSatansService and an unknown #Satanical acronym for #Dokken (A new “hole”) #WestboroBaptistChurchFooFightersHaHa #GrohlTrohl #ILoveYou #YouShouldBeDancing (Sounds like a #Footloose kinda scenario…)   (05:50) – Never mind the #pentagram…Bring on the #scary (Which album cover do YOU remember?) and the ultimate Alex ooooooh of approval / #PMRC and their #genius #marketing #strategy for #Metal #Hahahahahahahahaha #GFY #ParentsMusicResourceCenterStickersEqualCredibility #PMRC #ParentalAdvisorySticker #MarketingGenius #BuyME  #NoMistakes #Highlighter (#dontdenythepowerof #bureaucrats and #Metal) / The central difference between Too Fast For Love and Shout At The Devil / #KISSExposed***#OurNewSegment:  The #BeerOfTheEpisode #albumcover #StillfireBrewing #OrangeDiva #TallBoys #MetalNerderySalutes #HailToStillfire #cuethecrickets #HailtoStillOfTheNightFireCore #TheNewCore and #symbolism (and an eloquent label reading by Russell***    (12:40) – 200,000 copies in the first 2 weeks!?  #AlwaysRemember #WKLS96ROCK #nonaysaying / The Mick Mars “big” (#superbigly) #virtuosostank #heavysolo guitar sound (#SpinalTap #WaitWhat #KillBill #sorrybuddy) #toofar #wrongpipe #hollowpeenyos and #highfiber / #Bastard actually applies to #bolth ***CALL METAL NERDERY AT 980-666-8182 AND LEAVE A MESSAGE FROM A VOICEMAIL*** #illtakethewhats #thirtythirdfloorinvertedundergroundbunkerpoonstudios   (19:20) – Motley Crue at the US Festival (#noperiods #twentyeightdays) #FutureEpisodeBrainDump #Loads and #impossiblyhighexpectations (See also #London…almost like #earlyglammetal see also #SamDunn and his analysis of the various #Metal #Genres / Recording shit off of the radio #backintheday #crotchetyoldfucks /***Touring with #KISS vs Touring with #Ozzy*** / #deepthoughtsASMR #Gold and #Platinum #overtangentionalalityismness    (25:00) - ***Enjoy the Creepy***IN THE BEGINNING (#ithasbeenwritten) SHOUT AT THE DEVIL (#recordscratch #ChristopherWalking and #patreonideas) #yeah and the joy of finding one song that totally ear worms you and #replayingitoverandoverandover #hooks and #memories #AlwaysRemember / The “peak” of #MotleyCrue and their power! (…other than their #eponymous #album with #JohnCorabi) #magicburp   (31:45) – LOOKS THAT KILL (#earlythrash or #earlypowermetal maybe?) You've got to love the #gangvocals #midnightbong***that guitar solo is totally fucking heavy metal! *** #CBLE #HEY #TheMickSquealie #Mexican and #FridayNightCuisine ***GIVE US A CALL AT 980-666-8182 and give us some #input and/or #constructivefeedback *** / BASTARD, and the mystery behind the #guestdrummer & GOD BLESS THE CHILDREN OF THE BEAST (#taller #longer or #boLth?) ***BUY OUR SHIT AT metalnerdery.com/merch *** / HELTER SKELTER (See Also #TheBeatles See Also Also #CharlesMason for additional #tangentionalality) #dual #onmicburps #wondertwins #turnonthepower   (42:47) – The #killeropener for Side Dos:  RED HOT #alright #cantbeloudenough Definitely #classic #heavymetal #everybody #MotleyMaidenMoment / A Motley memory from back in the day…#myhonk #cokesuppositories #relaxersuppositories #gograbnutsforthewinter TOO YOUNG TO FALL IN LOVE #ducklips (***Remember #LeatherCharm aka early #Metallica? ***) #espifodes / KNOCK EM DEAD KID and the “synthesis” of multiple rock and metal styles into something that coalesced into this album   (53:08) - #UrbanLegend TEN SECONDS TO LOVE (#squishysounds #readthoselyrics #myhonk #alwaysremember) / DANGER (and a note regarding #thelasttrack on an album if it doesn't really fit the rest of the album) / Tracking changes #maxisong #notthepad / Memories regarding early Metal in the early 80's (specifically 1983…) / Future show ideas… and a collective #HAIL and #Farewell to those we've recently lost! #JoeyJordison #MikeHowe #DustyHill R.I.P. / #ThankYouForYourInebriation ***THANK YOU FOR YOUR CONTINUED LISTENERING AND SUPPORTERING OF THE METAL NERDERY PODCAST…#hiddentrack #Decimation #itsallbullshit #thereisnomoon 

1. RÜFÜS DU SOL - Next to Me 2. JLV feat. Cara Melipn & Jonas Brog - Change For The Better 3. Spada - Waiting (feat. Chiara Galiazzo) 4. Pontifexx, Uerep Romano - I Can't Lose This Time 5. Owwnboss, Bolth feat. Debbiah - Fly Away 6. What So Not - The Change (Feat. DMA'S) [Biicla Remix] 7. Taiki Nulight - Don't Wanna Let Go (ft. Eloise Keeble) 8. Alok & Malifoo - Teach Me 9. Dillon Francis - Reaching Out (feat. Bow Anderson) 10. Garmiani - FACETIME 11. DLMT - Don't Wanna Wait (feat. Laura Davie) (VIP Extended Mix) 12. House Divided - Want You 13. Dirty Sound Boys - Go Bro! 14. KLP & Stace Cadet - People Happy (Benson Remix) 15. King Topher & MUNNDAY - Pressure feat. Mao (Ralov Extended Remix) 16. Ayberk Cin - Without You feat. Yoelle 17. NO SIGNE - We Ride 18. Diego Miranda & Jenil Feat. Godoy Music - Energy 19. Bensley - Control Me 20. DJ Snake feat. Rick Ross, Rich Brian - Run It

Air Date: Friday August 13th 2021 Bart B More - Never Let It Go BYOR & VINNE - Downtown Nervo, Tinie Tempah, Paris Hilton - Pickle (Fluencee Remix) Cakes Da Killa x Proper Villains featuring Nomi Ruiz - ICU (10 Years Of Eats Everything Remix) 4brownbottles - Do It For Me Fedde Le Grand & Vince Freeman - Devils NØ SIGNE - We Ride Ryan Coss & Dalic - Dream Madison Mars & Ralph Aiden - Already Gone Rag - La Vida ID - ID [DARKLIGHT TEASER OF THE WEEK] Lion and Vencor - Nobody Work Donero - Move HÄWK - Tempted C-Dock - Traffic Jam [ALL TIME FAVOURITE] Kitone - No Slack Phlegmatic Dogs - Sandman DubVision - I Don't Wanna Know Costel van Dein - Bass Landers Plastik Funk & Oomloud - Ready Or Not Genuine Brothers - Louder Öwnboss, Bolth feat. Debbiah - Fly Away York - On The Beach (Kryder & JenJammin Sax Edit) Fedde Le Grand & Love Harder ft. Amy Grace - Same Thing Youtube: flg.dj/dls-yt 1001tracklists.com: flg.dj/dls-tr Website: flg.dj/darklight-sessions Darklight Sessions on Spotify: flg.dj/dls-sp Darklight Sessions on Apple Podcasts: flg.dj/apple More Fedde Le Grand: FeddeLeGrand.lnk.to/FindMe

Follow me: Facebook: fb.me/xabionly Twitter: twitter.com/xabionly Youtube: youtube.com/xabionly Mixcloud: mixcloud.com/xabionly Instagram: instagram.com/xabionly Spotify playlist: https://open.spotify.com/playlist/4STV7DPVgwI4ntvi1sQvjh?si=CU6lCNZcRkKiZytdXaI5TQ TRACKLIST: 01. Fabbrix, D-Steal, Dark Point - Life [Generation Smash] 02. Öwnboss, Bolth feat. Debbiah - Fly Away [GEMSTONE] 03. Leandro Da Silva - Yeah [Black Lizard] 04. Powered Djs, Black Winter & Omy Cid - Down Low [Future House Cloud] 05. Alex Nocera & Roy Batty - Inner Space [GEMSTONE] 06. Kryder & BJones - Girlfriend [SPINNIN] 07. Mark Roma ft. Lauren Nicole - Need Your Love [CAOS] 08. David Guetta & MistaJam feat. John Newman - If You Really Love Me (How Will I Know) (David Guetta & MORTEN Future Rave Remix) [Parlophone] 09. Achilles (OZ) - Touch Me 10. Ahmed Helmy - Never Fall [Interplay Records] 11. Laidback Luke & CARTA - Kong [PROMO OF THE WEEK] [REVEALED] 12. Justin Bieber - Hold On (W&W Festival Mix) [TRACK OF THE WEEK] 13. Ryos & Reggio feat. Linney - Battlefield [REVEALED] 14. Jack & James - Nothing Lost [REVEALED RADAR] 15. Colin Crooks, Philipp & Robbie Rosen - Survivors [REVEALED RADAR] 16. Diegx, Alkaz & SweetState feat. Eon Le Roux - The Way Out [REVEALED RADAR] 17. KAAZE - Dive [REVEALED] 18. Cosmic Gate & Diana Miro - Nothing to Hide [RELEASE OF THE WEEK] [Wake Your Mind] https://1001.tl/1gvu1r49

Har Jesper blivit ingenjör? Hur många vinkade Peter till i husbilen? Vilket namn borde Pontus ta som mellannamn? Allt detta och MER i dagens avsnitt av succépodden Tre inte så visa män!

Imagine the following scenario:  you are one of the most powerful names in all of Thrash and are tasked with releasing a follow-up to your own unmatched, game changing, genre defining, masterpiece.    Do you: A:  do what's “safe” and duplicate what you've already perfected (*yawn*)?  OR B:  continue to evolve and expand your sonic palette by changing your approach?   Thankfully, SLAYER went with option B, toning down the sonic chaos and breakneck speed of REIGN IN BLOOD with darker, slower, heavier riffs and an even creepier lyrical vibe.   JOIN US as we interview Kerry King's beard (just kidding; his beard couldn't be reached for comment) and immerse ourselves into the brooding and sinister evilocity of SLAYER's sophomore Def Jam release, SOUTH OF HEAVEN.   Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Show Notes: (00:00) - #hardintro (it's actually The Encyclopedia of Heavy Metal…)  #tonebone vs #episodebone and #lordoftheringswithtits #thingsweredifferentbackthen / ***BEFORE WE BEGIN…LOCAL METAL UPDATE!!!*** Keep an eye out for them (and go check them out and support them and buy their shit!!) #ActusReus (pronouncified ACT-us-RAY-us) #alloverthetopofhim See also #metalcore #moistASMR #onmicburpASMR Actus Reus should be going to #Rockville and playing #themainstage (bring your ones, people!) #BigDill (CULTIST) ***Check out the video! *** #HFS #sickaf #supportlocalmetal (09:46) - #nonaysaying #lubricated #friedpubes #breakfastofchampions also a mention and #tangentional shoutout to #BornOfOsiris ***CALL METAL NERDERY'S VOICEMAIL NOW 980-666-8182*** #withfeeling #notthatmuchfeeling and stepping out of your comfort zone #thirtythreeyears / #hallelujah Fucking Slayer's “South of Heaven” with an increased #creepy and #darkness factor even relative to Reign in Blood (compare the back album covers of #boLth Reign in Blood to South of Heaven…) #allegedly #eviler Where were YOU when you first heard Fucking Slayer's South of Heaven!? (And what was your first impression?)  (17:17) – July 5, 1988, and #dadsballs it's an #ology #waitwhat?  “Closeup of a WHAT!?” #mindvomit and #snortlaughter #revvedup #douchecanoe #ablaughter and the kind of laughter that goes on and on…#onmicburpASMR #moistASMR #artisticality #donteven #noteven #sheepchildren / SOUTH OF HEAVEN (#heavyasfuck and also #creepyasfuck) / Thicker, punchier, and deeper sounding than #RIB #specialfx and a word from Mr. Inslomo / Thinking back to #WREKage and when they'd play new tunes off of South of Heaven and the evolution of Slayer's sound musically & lyrically. (27:11) – A side article regarding #SouthOfHeaven (and an interview with Kerry King's beard, courtesy of #Revolver “9 things you didn't know about Slayer”) ***it was “Still Reigning” actually…*** and the perfectly timed segue into SILENT SCREAM (courtesy of #scrollsfromtheelder) #tentacledrums / Another food analogy that has a degree of #tangentionalality to the production of South of Heaven relative to Reign (Slayer's “…And Justice For All” perhaps?) #snortlaugh  (35:45) – LIVE UNDEAD (#postpostmortem) and the unsettling effect of the layered vocals /#fishshticks South of Heaven is like a buffet of #Slayer:  there's a little something for everyone / BEHIND THE CROOKED CROSS #cantbeloudenough and #thenewcore #audiocalgoncore #cheapseats #Brah / MANDATORY SUICIDE (#topfive #theultimatesacrifice #readthoselyrics #alwaysremember #neverforget #boLth) ***check out the outro on the “Still Reigning” version!!!  #haunting*** (46:43 – (Side 2) GHOSTS OF WAR #cantbeloudenough and a #ridiculously #forced #blackalbumreference #justthetip #dontforcenothin #idigest / READ BETWEEN THE LIES (#overthefence #fromthedeck) Slayer with more groove… / CLEANSE THE SOUL (a #happy little tune that's #stillevil and still #fuckingSlayer) #metalnerderyinvertedbunkerpoonstudios #prestigeworldwidestudios #marked (57:07) – DISSIDENT AGGRESSOR (#shoutout and #hail to #JudasPriest!) and nonsensical spewing during #picturetime / The rules behind how much “time” an artist had to fill on an album and how #covertunes became common in Thrash / Slayer's first #softintro (or rather an #evilintro) and a story regarding the Renaissance Festival #wenches and a shitty segue into SPILL THE BLOOD (#cantbeloudenough) #snorts (***check out the combo track of Chemical Warfare/Ghosts of War***) #listentothis #stopit (1:05:05) – Tracking changes? ***CALL US WITH ABSOLUTELY ZERO FEELING AT 980-666-8182*** #powerswordcore #ballsting #noteven #ididntknow (and a word from Christopher Walking…) / Artwork by Larry Carroll and production by Thrash Zen Master Rick Rubin and mastering by Howie Weinberg and mixing by Andy Wallace / Charting positions #moistness and #moistASMR #smellsgreat THANK YOU FOR LISTENING! and the #enigma that is the Metal Nerdery postproduction #softoutro #makingmyballshurt.  

The San Francisco Bay Area is a sacred place in thrash, birthplace to many legendary (and muchly important) thrash bands and equally lauded (which means muchly awesome) thrash albums.  FABULOUS DISASTER, the 3rd release from Bay Area Thrash Lords EXODUS is, without question, very muchly one of those albums.  And EXODUS is, also without question, also very muchly one of those bands. In fact, this may be one of THE MUCHLIEST thrash albums of 1989 (more on that later…muchly more).  Go ahead and get your orders phoned in for Ron's signature Emerald Triangle Jalapeno Relaxers (they're muchly delicious), pop the above-mentioned cassette in the tape deck of your low rider on side 1 while you channel your internal Cheech-energy and JOIN US as we salute one of the finest moments of late 80's-era thrash in existence.   Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Listen on iTunes, Spotify, Podbean, Google Play or wherever you get your Podcasts. ...and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app   Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Show Notes: (00:00) –  #whatsup with the #shots (I only need half a #dangol bowl) / A return to our 33rd Floor Inverted Underground Bunker Poon studios #innies and #outies (pooning the peen) and the #metaldecor courtesy of Billiam  / Diving into one of the Finest (and #bestest) moments in Thrash:  #Exodus Fabulous Disaster #notpassing #videomoviething #ultimaterevenge / Russell's updated 1990 look:  hard or soft? a #huge #eyerection / Ultimate Revenge numero uno #negativepositivereinforcement #yourewrong #waitwhat #oldfuck #driverslicense #pregrey and the story of The Stars and the process of renewals #ohno #pizzadelivery (10:32) – Released January 30th, 1989 (#TheHTeam and a bit of #tangentionalalityismness to Kirk Hammett and #theunnamedalbum) / Alpha & Omega Recording in San Francisco & released on COMBAT Records (***go check out our COMBAT episode!!***Also, Lee Altus was the answer we were looking for…) #sinnersac / #Zetro and the Bon Scott vocal sound ***check out #ACDZ***/ #kickoutthejams with #psychedelic #comicbooks #boLth or #boLf and people who don't speak #metalnerderyese / The C version vs the K version of the word #notbitter (we're teasing…) #mouthsounds #gohome #kuntkrickets  (nothing better than enjoying #relaxers whilst at #work)***PLEASE LEAVE US A RATING AND ANY FEEDBACK YOU'D LIKE TO SHARE WITH THE METAL NERDERY MULTIVERSE*** (19:55) – Show memories from the Fabulous Disaster #Headbangersball Tour 04/20/1989 at The Civic Center #flippin #noteven and a future Metal Nerdery concert field trip #blessing and a #jukebox / #backshadowing reverb THE LAST ACT OF DEFIANCE (with one of the most #badass intros EVAH!!) #killeropener #again (***see also Deranged***) #shortandcurlies and a word from Ron regarding The Rib Lounge #warmline at 980-666-8182 and the new #relaxers on #themenu  (26:24) – FABULOUS DISASTER (#digitalrecordscratch and the digital vinyl experience along with a fabulous and perfectly choreographed #onmicburp) / THE TOXIC WALTZ #headbangersballs #ballparties and more #krickets (#dances with #nuts) and a brief shoutout to #sweetwaterbarandgrill #balltoball and being in the #moshpit with a walker and/or cane and reasons to work out and exercise as you age / The amplification used on Fabulous Disaster (see also Tom Langner #hotrodded and #modded #marshalls) #regrets and #blowingtubes (37:35) – LOW RIDER (a #covertune by #War with commentary courtesy of #cheechchannelling) #dedicatedtorelaxers / CAJUN HELL (#veryvisual and also #verycreepy) and potentially crazy tour stories from the #bayou / Side Dos:  LIKE FATHER LIKE SON (#thelongest) #readthoselyrics / The #progressive element in #thrash, a #preblackalbumreference and having multiple parts with multiple #crunchyballriffs packed into a single song / #wingsauce (47:12) – Dedicated to #bureaucrattrash and #humangarbage #everywhere CORRUPTION (#letUSknow #tellUShow) #yogametal #thenewcore #audiocalgoncore (I #seent it be #spillt) #hail to #boLth / VERBAL RAZORS (and a #shoutout to that technical Angus Youngian #riff #canyoufeelit #letitringout) #readthoselyrics and #prebackshadowing and #thelasttrackofdefiance OPEN SEASON (is that #spiritualhealing or perhaps a #ghostinthemachine?) (55:09) - #boneus track (that particular #blackalbumreference was mostly Russell's fault!) and the colors of various albums from a certain band possessing #tangentionalality to #Exodus / #akkadakka #ACDC and an #excellent #cover of OVERDOSE proving that #ACDCismetal / ***The NEW #Exodus album is PERSONA NON GRATA…coming in November*** (originally scheduled for a June releasestical date) / #Rockville #metalfestival #kentuckyjelly #fourthings Not sure Exodus is #deathmetal (and a shoutout to “the part of me that's always 16…”/ #WTF is it with #metalbands NOT coming to the #ATL !? / And a slight moment of #transgentionalalityismness / Fabulous Disaster is definitely a Filet Mignon / Any relevant tracking changes are thanks to the #blackdog and also #thankyou for listening!! / ***CALL METAL NERDERY AT 980-666-8182*** and also phone in your order for Ron's special pork loin & jalapeno infused #relaxers ***GO BUY OUR SHIT at metalnerdery.com/merch and send Lars some gum on the #gumapp #tridentvibes  #untilthenext #farewell #scrambledeastereggs.

Bolth!? You're taking an L if you pronounce "both" that way. Trey and Jake discuss their favorite pizza place in a fabulous part of town. They also talk about the lobster fisher who was swallowed by a whale. Support the show! www.betterhelp.com/correct 10% off your first month! www.canva.me/trey Look more professional with Canva Pro Get 45 days of Canva Pro for FREE!!!! Subscribe to the channel: https://www.youtube.com/channel/UCL3ESPT9yf1T8x6L0P4d39w?sub_confirmation=1 Become a Do Less Guest: https://treykennedy.com/patreon/ Love the opinions, but hate the ads? Subscribe to the ad-free version of Correct Opinions here!: https://correctopinions.supercast.tech/ Subscribe to Correct Opinions on Apple: http://bit.ly/COPodcast Buy my merch: https://fanjoy.co/collections/trey-kennedy Learn more about your ad choices. Visit podcastchoices.com/adchoices

Bolth!? You're taking an L if you pronounce "both" that way. Trey and Jake discuss their favorite pizza place in a fabulous part of town. They also talk about the lobster fisher who was swallowed by a whale. Support the show! www.betterhelp.com/correct 10% off your first month! www.canva.me/trey Look more professional with Canva Pro Get 45 days of Canva Pro for FREE!!!! Subscribe to the channel: https://www.youtube.com/channel/UCL3ESPT9yf1T8x6L0P4d39w?sub_confirmation=1 Become a Do Less Guest: https://treykennedy.com/patreon/ Love the opinions, but hate the ads? Subscribe to the ad-free version of Correct Opinions here!: https://correctopinions.supercast.tech/ Subscribe to Correct Opinions on Apple: http://bit.ly/COPodcast Buy my merch: https://fanjoy.co/collections/trey-kennedy Learn more about your ad choices. Visit megaphone.fm/adchoices

“We're MOTORHEAD and we play rock ‘n' roll…”  -Lemmy Kilmister.    It has been said that if you go to the Rainbow Bar & Grill in West Hollywood, sit down at the bar, and order a Jack & Coke, the spirit of LEMMY KILMISTER will manifest as a cloud of cigarette smoke and tell you to get out of “his spot”.   For over 4 decades, MOTORHEAD pummeled fans with their abrasive, uncompromising brand of metal fueled by speed, attitude, and vice, firmly securing their place at the base of the foundation that helped shape the burgeoning New Wave of British Heavy Metal movement.   “…and don't forget the joker.” -Ace of Spades   Time to pour yourself a Jack & Coke, assemble whatever relaxers you have that pairs well with a Jack & Coke, ante up for Lars' gum app and JOIN US as we sample a tiny swath of the vast back catalog of the mighty and powerful MOTORHEAD (warts & all). Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Play or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com Show Notes:   (00:00) – Clinky to the #brandnew #notsatan NOW RECORDING in our 33rd floor underground recording #bunker #boLth #prepoon and #postpeen studio updates #undergroundbunkerpoon / #recordscratch the ultra-Alex #ooooh of approval and a special day for #metalnerderypodcast TWO YEARS OF METAL NERDERY PODCASTERY!!!!  #crazy / Russell's #disclaimer of #wrongness #violenceband vs #intruder (They're so similar and they're just alike) and Russell's Rant (#ohgeez) regarding #gasstations #checkouts and #necktattoos that don't age well (just as with all other tattoos…) #nonecktats #justrelaxers   (05:55) – Open the #mailscrotum to read a message from the #podbean #hailtothefallen #alwaysremember #neverforget and thank you for checking us out and the #dopeness of #postpoonstudios with #greatpersonality and the thing about #laughter / Things to NOT listen to on #family #vacations (actually, things you SHOULD listen to on family vacations) and a secret behind the scenes moment / The source of Lemmy's #metalpower / What was YOUR first #Motorhead #rememberance?  Remember The Young Ones?  #thereitis    (10:28) – EAT THE RICH (music video version) #onmicburp #bumbum and #throathole (AC/DC + early Thrash = Motorhead) #meattorpedo (see also 1987…go back to 1975 for the #beginning) / Lemmy and his #tangentionalalityismness to Jimi Hendrix as a #roadie and one of the most Metal moments in Metal and/or rock & roll and/or #boLth / (But first…) The First Song from #thefirstnewalbum (it's Motorhead's Exciter) MOTORHEAD (1975) and their legacy / It's actually Motorhead's Black Sabbath aka and/or Exciter and/or/and/or Iron Maiden (and the fulfillment of Metal prophecy and also the #cricketquota) “We're Motorhead and we play rock'n'roll!”   (19:07) – Ever heard Motorhead's version of WHIPLASH by #Metallica? (See also Metallic Attack) #notchristmasmusic #readthoselyrics to see the Motorhead lyrics #happiness and another #onmicburp #asofrightnow #newsflash and a Metal story that sounds like it was from #babylonbee and/or #theonion ***BUY OUR SHIT!! metalnerdery.com/merch #chewchew*** Some backstory regarding the mighty and powerful Lemmy Kilmister and the embodiment of Heavy Metal (“If you think you're too old to rock ‘n' roll, then you are.”) and a tangentional discussion regarding #shorts.    (24:52) - #droneystoney ORGASMATRON (very #stoner sounding) #thenewcore #standbycore #earlyvikingstonermetalcore / The concept of an artist's creative palette and the impact on a band's sound (and the ultimate realization that you will ultimately cannibalize your own riffs to some extent) / Fuzzy recollections regarding past #showmemories #hesafuck #hewont #hesinjell #notbitter and not #startstruck #woetoyou #hell #themasquerade #intimate (and another #epical #onmicburp)    (32:13) - HELLRAISER (see also #Ozzy version) missing the Zakk Wylde #squealies / #canyouimagine If you could make a #billion off a #turd would it be worth it? #enjoythatmoney / #livinglegendaward and a story regarding a trip to Lemmy's spot at The Rainbow in L.A. (***check out the LEMMY DVD***) #dumbpunalert #cunttreeart is also known as a #ruralmural / The Dave Mustaine of Motorhead and past Motorhead members #andor END OF TIME and #laypeople (from Aftershock-2013…featuring Mikkey Dee on the drums) Motorhead is like #oldfaithful #dependable    (39:54) – Tentacle overload KILLED BY DEATH #dontsayit (meaning ‘don't say' the name of the favorite album of ninjas worldwide #motherfucker) / STONE DEAD FOREVER (***see also Metallica's Garage Inc for some #excellent Motorhead covers***) #thenandnow and #nowandthen and #crickets and #finally ACE OF SPADES #cantbeloudenough   (47:56) – The vocal stylings of speed metal vs #Lemmy and one of the most #metal #logos in all of Metal.  #umlauts #aka #motleycrue dots and Matt's misunderstanding of the concept of #antibodys / Ways to get good at what you're doing #dontgiveup #keepgoing #repetition and #consistency / Motorhead's logo #critter #warpig and/or #snaggletooth and some #tangentionalalityismness to #boLth #LedZeppelin and #PinkFloyd ***CALL METAL NERDERY AND LEAVE US A VOICEMAIL AT 980-666-8182!!! CALL NOW *** #youarenumbersix and the great #bobrock #gumout of 1991 and a #beautiful #blackalbumreference to close out the show #untilthenext #eastereggage.  

THE SWORD is truly a blessing.  Blending the crushing heaviness and urgency of their own cutting-edge brand of doom metal with the cosmic feel of classic 70's style prog-rock, THE SWORD has carved out their own place in the pantheon of modern metal.   Set your relaxer levels to “wormhole” (don't make it weird), check out the name of The Rib Lounge's new house band (it's actually even weirder than “wormhole” if you can believe it, although you're probably still stuck on “wormhole”) and JOIN US as we time travel through the multi-verse to sample but a slice of the doom-prog metal genius of that little old band from Austin.   HAIL THE SWORD.   Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Play or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Show Notes:   (00:00) - Do YOU remember the first time you heard #TheSword? Nothing but the highest #kudos and #commendments from #everyone  #replacementtherapy #replacementsabbath and a moment of #tangentionalalityismness with #relaxers and #breakingbad and #gameofthrones (aka #lordoftheringswithtits #lotrwt #RJD will be doing the #soundtrack) /#timetraveling the #catalogue of #TheSword and also #btw #thesword is coming to town (with #primus and #wolfmother #boLth #goodwithrelaxers) #thenewcore #titfreestonermetalzeppelincore #notits / justification for concert ticket prices (how to allocate your entertainment dollar for #liveshow #justification / #themainstage vs #thesidestage #sorta #dontmakeitweird   (7:57) – #TheSword and #Austin #Texas and #willienelson / #talentedtentaclesThe latest greatest hits collection (Conquest of Kingdoms) from The Sword #gobuyit (BARAEL'S BADE) #CBLE #bongasaurus #shagcarpeting #woodpaneling #uglygreencouch (WINTER'S WOLVES) ***check out Metal Nerdery's upcoming Stoner release*** #thatssosabbath #beatit #onmicburp and a contact high from the performance   (13:30) – THE FROST-GIANT'S DAUGHTER (from God's of the Earth) and The Sword's #gear #gibson #orangeamps (there's your answer:  #orangeisthenewfuzz) and the #evolution of The Sword's #sound / The rule of Instrumentals (and the rule of #crickets and #rulebreaking) #turnthecricketsup #throatrelaxers and #tambourines #youbetter (LORDS- also from God's of the Earth) and the return of #prog to #metal (there's a difference between prog and just “jam bands”) #howmuch #code   (21:42) – The transition from the #stonerdoom to more of a #stonerrock #sound and #warpriders / #thankyouforthat #gross #thenextnewcore #progressivestonermetalcore  #nausea another #newcore? TRES BRUJAS #zzfrehley (Three Witches, NOT 3 beers) #swingy with #sacredsmoke from #certainherbs  #myjam #readthoselyrics You can definitely smell the sound of that jam room…and the return of #JeanWree #genre #stopit / #newmetalnerderyhqequipmentcore #ijustdidit #makeupcore.   (26:39) – CLOAK OF FEATHERS (from Apocryphon) #fuckyeah #bolth and Christopher Walking's special request  #christopherwalking #leftturn and a word from Marc Potterson #ilovethesword differently than #ilovethehelmet / VEIL OF ISIS (check out the #musicvideo) #verysabbath #mysticalsabbath #stonersabbathdiocore #culturalist and the #prefuckyou to #cancelculture #crickets #itsnotenough #fuckyourcancelculture and a divergence into something else involving #boLth #JRE and #chappelle and a #supervillian   (34:07): - #thefuzz #easeintoit #rawdog (HIGH COUNTRY and a production change from prior albums makes #excellent #thememusic The Sword expanded and evolved their sound much in the same way as Sabbath #testicleecstasy #canada #deranged MIST AND SHADOW #postproducedwhispers #whisperASMR (dial in your relaxer levels for 1971) & #creepingmeout with #carelesswhispers and #hellsbells TURNED TO DUST and a deviation from the septum over to THE BEES OF SPRING #stevemillerish) / When artists step out of their #comfortzone it often brings out their #magic (#lowcountry is what you were looking for)   (41:51): – DEADLY NIGHTSHADE (and a shoutout to Lord of the Rings…with tits) & THE WILD SKY (and another Marc Potterson moment) / DON'T GET TOO COMFORTABLE (#metalnerderywaterbottleASMR) #fuzzy and then back to #thefirstnewalbum (HORNED GODDESS) #metalnerderyconcertannouncementASMR #bakersbuttload #alotoftits #killerstonerbandname and a #ridiculousreach for a #blackalbumreference via #stevemartin   (49:10): – A non #tangentional discussion regarding #vacations and an #easycheapone definitely #turnoffyourphone #relaxeraccess ***CALL THE METAL NERDERY HOTLINE NOW at 980-666-8182*** #dontdenythepowerof / ***BUY OUR SHIT!! metalnerdery.com/merch ***and a #shoutout to #tridentvibes #refreshed #newsteded #haironthearms #untilthenext #checkoutthesword #prisonpurse #eastereggmadness.