Podcasts about Hail

Share on
Share on Facebook
Share on Twitter
Share on Reddit
Copy link to clipboard

Form of solid precipitation

  • 3,450PODCASTS
  • 5,387EPISODES
  • 51mAVG DURATION
  • 2DAILY NEW EPISODES
  • Oct 22, 2021LATEST
Hail

POPULARITY

20112012201320142015201620172018201920202021


Best podcasts about Hail

Show all podcasts related to hail

Latest podcast episodes about Hail

Shattered Cast Uncut
All Hail Unicron Episode 3: The Not So Tfcon Special!

Shattered Cast Uncut

Play Episode Listen Later Oct 22, 2021 80:42


All Hail Unicron: Episode 3   INTRODUCTION   Anybody Get Anything?   Movie News Third party news Third party legends scale trainbots? https://fb.watch/8JPwrjTg_-/   Moon studios Iceland  https://www.facebook.com/100050551416583/posts/430203795341331/?sfnsn=mo   Moon studios MS-01 Dark Knight https://m.facebook.com/story.php?story_fbid=430217698673274&id=100050551416583   Devil saviors DS-06 sweeping  https://m.facebook.com/story.php?story_fbid=431744311853946&id=100050551416583   Cang Toys Razorclaw   Official news: Haslab Fully Funded (all Tiers) https://hasbropulse.com/collections/haslab/products/transformers-victory-saber   MP Shouki w/ Diorama Pictures https://news.tfw2005.com/2021/10/16/takara-tomy-transformers-mpg-01-trainbot-shouki-x-tomytec-diorama-images-443078#images Statue-ish News: Yolo Park Optimus Model Kit: https://news.tfw2005.com/2021/10/15/yolopark-bumblebee-movie-earth-mode-optimus-prime-plamo-model-kit-assembly-sample-images-442991 Three ZeroOptimus: https://news.tfw2005.com/2021/10/13/mdlx-optimus-prime-by-threezero-official-pics-and-details-442801 Discussion:     Questions:   Email your questions to: Hailunicroncast@gmail.com    Special Shoutouts: Dustmightz for providing the beats for the theme song! Check the Realm of Collectors on Facebook! https://www.facebook.com/groups/realmofcollectors   Everyone who followed us from Shattered Cast Uncut, we are grateful to each and everyone of you for joining us on this journey!   Hosts: T2RX6 http://www.youtube.com/user/T2rx6 Mathew Deluxe Baldwin https://www.youtube.com/c/DeluxeBaldwin Oscar Alonso https://www.youtube.com/user/oscarnjboy Robert Duyjuy-sabado-gigante

Nose Bleeds  Sports PodCast
Nose Bleeds "171" All Hail, The Rat King

Nose Bleeds Sports PodCast

Play Episode Listen Later Oct 21, 2021 90:38


It's a busy episode of NBSP. Week 7 NFL Picks, NBA Opening Night and the Ben Simmons saga, MLB Playoffs, Mount Rushmore of comedians who play instruments on stage, and Theo Von's new special, Regular People.

UltraChenTV
SNKronize Ep. 035: Hail Heidern [SNK Podcast]

UltraChenTV

Play Episode Listen Later Oct 21, 2021 132:18


SNKronize: SNK Podcast w/ James Chen (@jchensor), OlafRedland (@OlafRedland), & KittyKaboooom (@KittyKaboooom) Episode 35, October 20th 2021 The SNKronize boys break out the magnifying glasses to take a closer look at the new KOF XV Heidern reveal trailer, along with some remaining roster speculation as they toss around a few fantasy teams. - SNKronize Episode Links - YOUTUBE: www.youtube.com/UltraChenTV SPOTIFY: tinyurl.com/UCTVSpotify - The Chensor Dynasty - Please follow and consider subscribing to The Chensor Dynasty stream on Twitch: twitch.tv/jchensor Support and Follow James On Other Social Media Platforms: Patreon: patreon.com/jchensor Twitter: twitter.com/jchensor And join The Chensor Dynasty Discord! discord.gg/2RVPc9C A friendly FGC environment designed to be welcoming to newcomers and beginners and those that want to have a positive atmosphere to discuss their favorite hobby of Fighting Games! - UltraChenTV - Please consider also supporting the UltraChenTV Patreon! patreon.com/ultrachentv Twitch stream - twitch.tv/ultrachentv Twitter - twitter.com/ultrachentv UltraDavid - twitter.com/ultradavid TuboWare - twitter.com/TuboWare #FGC #Podcast #Esports

The Jasta Show
Show #611 - Marc Rizzo (Ex-Soulfly/ Hail The Horns)

The Jasta Show

Play Episode Listen Later Oct 21, 2021 102:12


Marc Rizzo Formerly of Soulfly, currently out on the road with Hail The Horns, is my guest on this brand new episode of Th Jasta Show! On this one Marc and myself get into some of our favorite old TV shows and commercials, the singer of smash mouth getting himself into trouble again, and how to get back on the road after two years off. Check it out!Support Our SponsorsIndie Merch Store - https://www.indiemerchstore.com use promo code JASTA10 at check outMartyrstore - https://martyrstore.net use code JJ15The Mad Russian Apothecary - https://www.madrussianapothecary.com use code JASTA21Promescent - Use this link: https://bit.ly/3y9jZAP to get 15% off + free shipping automatically added on all orders!Seek and Strike - https://www.seekandstrike.com/Blue Chew - https://bluechew.com code JASTARockauto - https://www.rockauto.comFind Hail The Horns News Herehttps://www.facebook.com/hailthehorns/Subscribe On GaS Digitalhttps://gasdigitalnetwork.com/gdn-show-channels/the-jasta-show/USE PROMO Code JASTA for a 2 week free trial.Follow Jamey On Patreonhttps://www.patreon.com/jastaFollow The Show On Social Mediahttps://twitter.com/jameyjastahttps://www.instagram.com/jameyjasta/https://twitter.com/bmackayisrighthttps://www.instagram.com/bmackayisright/Musician, former television host, and podcaster Jamey Jasta (Hatebreed, Kingdom of Sorrow, Jasta and the former host of MTV's Headbanger's Ball) interviews your heroes every Monday and Thursday. The newest 20 episodes are always free, but if you want access to all the archives, watch live, chat live, access to the forums, and get the show a week before it comes out everywhere else - you can subscribe now at gasdigitalnetwork.com and use the code JASTASee Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Ballad of the Seven Dice
Act III Chapter III - All Hail Prince M‘zi Part 3

Ballad of the Seven Dice

Play Episode Listen Later Oct 20, 2021 51:45


Welcome to Ballad of the Seven Dice. Our heroes are reunited once more and head to Tul'narath to save their friend M'zi. Can they make in time? Will the Lich Queen imprison them? Find out today! Surprise Guest Dave Cole of Four Orbs playing TI-426.  Show Notes Ballad Theme, Inn of the Seven Dice, The Pendulum's Swing  - Dave Cole  Michaël Ghelfi - RPG Ambiences Vol. 1 - 23 On The Shore Graham Plowman - The Great Old Ones and Other Beings - 08 Of Elder Things and Shoggoths City of Smoke - Platemail Games http://platemailgames.com/  Stormfront - Kevin Macleod Link: https://incompetech.filmmusic.io/  License: http://creativecommons.org/licenses/by/4.0/  Fantasy Ambience by Alexander Nakarada Link: https://incompetech.filmmusic.io/  License: http://creativecommons.org/licenses/by/4.0/  TheGreatUnknown - Audionautix http://audionautix.com/index.php  Doors and Portals - Heavy Wood Door - Novak Cuic  

Fantasy Scouts Podcast
Ep 31: All Hail King Henry

Fantasy Scouts Podcast

Play Episode Listen Later Oct 20, 2021 79:29


The Fantasy Scouts are back with a new episode! In today's episode, the Scouts continue with their in-season reactions and react to some of the bigger storylines from around the NFL. Today's show includes: Discussing the Zach Ertz trade to Arizona and how it impacts his value as well as Dallas Goedert's value, Derrick Henry is showing no signs of slowing down, are NFL teams shifting to more of an RBBC approach, the QB landscape across the league, and a fun game of would you rather! For more inside info, check out patreon.com/fantasyscouts !

P.U.G.S. (Players Underground Gaming Society)
Tales of Aezeron Ep 19 Tournoi du Arbmos pt 5 Visions in the Night (It's Sais Fault)

P.U.G.S. (Players Underground Gaming Society)

Play Episode Listen Later Oct 20, 2021 103:43


Hail and well met Adventurers!After a very long hiatus the P.U.G.S. crew is back with more new episodes of your favorite adventuring group!  After the parties encounter with the mighty morphin power specters they head towards the inn for a brief respite before Morgrims encounter with his former lover Lieutenant Baker.  But as they say there is no rest for the wicked and the party will soon find themselves finding out the hard way as to why that saying is true.

HAIL PODCAST!
Hail Podcast 10-19-2021

HAIL PODCAST!

Play Episode Listen Later Oct 19, 2021 65:43


Hail Podcast 10-19-2021

The Breakfast Club
All Hail the Queens (Eve, Naturi Naughton, Nadine Velazquez and Brandy)

The Breakfast Club

Play Episode Listen Later Oct 19, 2021 111:50


Today on the show we had some Queens stop by, to talk about their show Queens on ABC. Eve, Naturi Naughton, Nadine Velazquez and Brandy spoke about their chemistry on the show and what the audience could expect from watching it and more. Also, Charlamagne gave "Donkey of the Day" to a Subway worker who was fired after recording himself trashing the kitchen. Also, we opened up the phone lines to see if our listeners beleive in marriage or not after video came out of Jamie Fox speaking about his uninterest in marriage again. Learn more about your ad-choices at https://www.iheartpodcastnetwork.com

What Up Patna
Raw Un-Cut Mic-Check Prep Sesh Brooksenberg Bonus

What Up Patna

Play Episode Listen Later Oct 19, 2021 11:21


This entire segment was recorded with the laptop microphone. Hail to the mic-check which is why we caught it and ensured a dope show to follow. Too cool not to post tho so enjoy this Raw Un-Cut Mic-Check Prep Sesh Brooksenberg Bonus with special returning guest Mr. David Jasso Patna!!! Such good times with the newest Patnas joining the dojo and to top it off we motivating everyone tanight!!! Stay tuned for #86 Patna... --- Send in a voice message: https://anchor.fm/whatuppatna/message Support this podcast: https://anchor.fm/whatuppatna/support

GoCast: a Pokemon GO Podcast
165 - Candy, More Candy, and Even More Candy

GoCast: a Pokemon GO Podcast

Play Episode Listen Later Oct 18, 2021 100:18


This year's Halloween event is one you won't want to miss-chief! A new change will help the egg hatchers in your life get crackin'! Hail to the king… but only after you've caught 30 of his friends! Pump up the volume for some spooky Lavender town vibes! -- and more on this episode of GoCast!Pokémon GO Halloween 2021Coming Soon: Testing ImprovementsPhantump - Trevenant - StatsMore FishonaHeaterMore DPhiET-shirt to support Trainers!Visit our website - www.gocastpodcast.comSupport us - www.patreon.com/gocastpodcastEmail us - mail@gocastpodcast.comFollow us on Twitter - @gocastpodcastLeave us a voicemail - (262) 586-7717‬Subscribe on YouTube - https://www.youtube.com/c/gocastpodcastFollow on Twitch - https://www.twitch.tv/gocastpodcastSupport the show (https://www.patreon.com/gocastpodcast)

Pantheon: Rise of the Fallen - Rewind
Rewind - Episode 75 - Dev Streams & Referral Dreams

Pantheon: Rise of the Fallen - Rewind

Play Episode Listen Later Oct 17, 2021 68:16


In this episode. Desryn and Therek recap the October VR Dev Stream, discuss the ins and outs of the new Refer a Friend Program, and wrap up The Bait, Part Two with another lore reading. Support the show on Patreon!https://www.patreon.com/PantheonPlusJoin Our Community:PantheonPlus Discord: https://discord.gg/FDJMcHNPantheon.Plus - https://www.Pantheon.plusTwitter - https://www.twiter.com/PantheonPlusTwitch - https://www.twitch.tv/PantheonPlusYoutube - https://www.youtube.com/PantheonPlusShow Links and Credits:VR News and NotesPantheon: http://www.pantheonmmo.com/Pantheon Twitter: https://www.twitter.com/PantheonMMOPantheon YouTube: https://www.youtube.com/pantheonriseofthefallenPantheon DRT RSS Feed: https://feeds.buzzsprout.com/1825341Music Credit:"Cipher" Kevin MacLeod (incompetech.com)Licensed under Creative Commons: By Attribution 4.0 Licensehttp://creativecommons.org/licenses/by/4.0/Community Discussion“Refer a Friend (Please dont do this to me)” by Grimseethehttps://seforums.pantheonmmo.com/content/forums/topic/13287/refer-a-friend-please-dont-do-this-to-me“Hail, friends!” by Nemufaehttps://seforums.pantheonmmo.com/content/forums/topic/13285/hail-friends/view/post_id/256712“The Journal of H. Weissen Thalesred; Page 7” by wizenhttps://pantheon.plus/article/fc07cd6c-4dbd-4cf1-b1a4-08d5f444756c“THE MAP: World Building with the Silent Plains” by benonaihttps://pantheon.plus/article/e09e0c9e-30e8-4888-9568-3f37574ba6fcThe Lore You KnowThe Bait, by JN Gerharthttps://www.pantheonmmo.com/newsletter/_2021/september/the-bait-2/Sounds used per Adobe Software License Agreement http://www.adobe.com/products/eulasYouTube Audio LibraryMusic Credit:  - "The Pyre" Kevin MacLeod (incompetech.com)Licensed under Creative Commons: By Attribution 4.0 Licensehttp://creativecommons.org/licenses/by/4.0/"The Snow Falls"https://soundcloud.com/pantheon-rotf/the-snow-falls

Drew and Mike Show
Drew And Mike – October 14, 2021

Drew and Mike Show

Play Episode Listen Later Oct 14, 2021 155:26


Brian Laundrie's new look, Joe Rogan v Sanjay Gupta, Kyrie Irving speaks, don't talk about Jonah Hill or Lizzo's weight, a Bonerline, Maz checks in, Pete Rose killed Ray Fosse, and CBS gets our sloppy seconds.Listen to your "safe for work" show on WLLZ this and every weekend.Show Health: Drew's hip hurts. Marc can't see. Brandon doesn't go to the dentist. Don't even get us started on Trudi.Drew has been binging Dave & Chuck the Freak in preparation of his WATP appearance tomorrow.Storytime with Seth Rogen is the latest celebrity podcast.Jonah Hill is very insecure about his body. He doesn't want bad OR good comments. Lizzo was... but apparently is no longer insecure about her body.Kyrie Irving breaks his silence about not getting the covid vaccine. Twitter is mad that he did an Instagram Live during a WNBA game.Jerkmate (NSFW link) brings you a brand-new Bonerline. Dial or text 209-66-Boner.Curtis Smith is making the rounds. We had him FIRST!Manchester schools and parents cannot meet in the middle about masks, but some people need to learn how TV interviews are conducted.Mellissa Carone wants to be a politician now.Hail to the Victims. Dr. Nassar victims join the Dr. Anderson victims protesting outside the UofM President's house.Chick-fil-A is about to cause joy and havoc in Woodhaven.Where the hell is Ronald McDonald?If your African cats get loose more than once then: No more cats for you!Ramzu Yunus seems to be the only guy that has ever "won" a standoff. Also, don't accept a deed from him.4 Northland Mall security guards are being charged in the 2014 death of McKenzie Cochran.We interrupt Tom Mazawey's show prep to chat Jon Gruden fallout, defend murderer OJ Simpson, the softness of high school soccer, comment on Kyrie Irving and preview the weekend sporgy.RIP Ray Fosse. Some people are saying Pete Rose should be arrested for murder.Colin Kaepernick is ready for his NFL comeback. Where is Cam Newton going to land?Special Agent Gibbs is leaving NCIS and we dial up Count David Wimp to see if he's ok.Laundrie List: Dog the Bounty Hunter and John Walsh are receiving heat. Brian's sister is getting death threats. Internet sleuths believe Brian Laundrie looks like Paul Rudd now. Joe Rogan is angry CNN said he took "horse de-wormer" and he took it out on Sanjay Gupta.Tis the season for schools to cancel Halloween.Jim Bakker is still selling Doomsday products.Check out what Charlie LeDuff and ML Elrick are up to.Social media is dumb but we're on Facebook, Instagram and Twitter (Drew and Mike Show, Marc Fellhauer, Trudi Daniels and BranDon).

Complex Trauma Recovery; We Are Traumatized M***********s
Off Script. Going No-Contact and Reclaiming Your Brain

Complex Trauma Recovery; We Are Traumatized M***********s

Play Episode Listen Later Oct 14, 2021 52:25


Ever feel like you're not allowed to be yourself? Like your words aren't valid? Like your only utility is performing for others? And all the rest is "N/A?" Yeah... So, as you might guess, mental health podcasting got to be a hard effort after being immersed in my Family of Origin for a year. But with a solid month of "no contact" comes the re-mergence of access to your own thoughts and feelings again. Fucking fancy. Today, I'm taking ten steps backwards and radioing in with a conversation and community discussion, rather than a 20 page research essay. Talking off the cuff, openly, and honestly about the ups and downs of living with a T-Brain... the way this project was always supposed to be. Let's cover: cognitive-emotional changes and visceral memory findings during seasonal changes our trauma-complicated relationships with "routines" YOUR best grounding habits dissociative identity resources (Janina Fisher, anyone?) dating on trauma brain community changes & the call for your MF stories and this month's Ask Me Anythings, streaming exclusively at patreon.com/traumatizedmotherfuckers For more information, to contribute, or to join the TMFR / YSFB community, hit up www.t-mfrs.com or email me at traumatizedmotherfxckers@gmail.com Hail your Self. Hail Archie. Cheers Y'all. -YerMotherfuckerJess --- Send in a voice message: https://anchor.fm/complextrauma/message

ESV: Chronological
October 14: Matthew 27–28

ESV: Chronological

Play Episode Listen Later Oct 14, 2021 10:18


Matthew 27–28 Matthew 27–28 (Listen) Jesus Delivered to Pilate 27 When morning came, all the chief priests and the elders of the people took counsel against Jesus to put him to death. 2 And they bound him and led him away and delivered him over to Pilate the governor. Judas Hangs Himself 3 Then when Judas, his betrayer, saw that Jesus1 was condemned, he changed his mind and brought back the thirty pieces of silver to the chief priests and the elders, 4 saying, “I have sinned by betraying innocent blood.” They said, “What is that to us? See to it yourself.” 5 And throwing down the pieces of silver into the temple, he departed, and he went and hanged himself. 6 But the chief priests, taking the pieces of silver, said, “It is not lawful to put them into the treasury, since it is blood money.” 7 So they took counsel and bought with them the potter's field as a burial place for strangers. 8 Therefore that field has been called the Field of Blood to this day. 9 Then was fulfilled what had been spoken by the prophet Jeremiah, saying, “And they took the thirty pieces of silver, the price of him on whom a price had been set by some of the sons of Israel, 10 and they gave them for the potter's field, as the Lord directed me.” Jesus Before Pilate 11 Now Jesus stood before the governor, and the governor asked him, “Are you the King of the Jews?” Jesus said, “You have said so.” 12 But when he was accused by the chief priests and elders, he gave no answer. 13 Then Pilate said to him, “Do you not hear how many things they testify against you?” 14 But he gave him no answer, not even to a single charge, so that the governor was greatly amazed. The Crowd Chooses Barabbas 15 Now at the feast the governor was accustomed to release for the crowd any one prisoner whom they wanted. 16 And they had then a notorious prisoner called Barabbas. 17 So when they had gathered, Pilate said to them, “Whom do you want me to release for you: Barabbas, or Jesus who is called Christ?” 18 For he knew that it was out of envy that they had delivered him up. 19 Besides, while he was sitting on the judgment seat, his wife sent word to him, “Have nothing to do with that righteous man, for I have suffered much because of him today in a dream.” 20 Now the chief priests and the elders persuaded the crowd to ask for Barabbas and destroy Jesus. 21 The governor again said to them, “Which of the two do you want me to release for you?” And they said, “Barabbas.” 22 Pilate said to them, “Then what shall I do with Jesus who is called Christ?” They all said, “Let him be crucified!” 23 And he said, “Why? What evil has he done?” But they shouted all the more, “Let him be crucified!” Pilate Delivers Jesus to Be Crucified 24 So when Pilate saw that he was gaining nothing, but rather that a riot was beginning, he took water and washed his hands before the crowd, saying, “I am innocent of this man's blood;2 see to it yourselves.” 25 And all the people answered, “His blood be on us and on our children!” 26 Then he released for them Barabbas, and having scourged3 Jesus, delivered him to be crucified. Jesus Is Mocked 27 Then the soldiers of the governor took Jesus into the governor's headquarters,4 and they gathered the whole battalion5 before him. 28 And they stripped him and put a scarlet robe on him, 29 and twisting together a crown of thorns, they put it on his head and put a reed in his right hand. And kneeling before him, they mocked him, saying, “Hail, King of the Jews!” 30 And they spit on him and took the reed and struck him on the head. 31 And when they had mocked him, they stripped him of the robe and put his own clothes on him and led him away to crucify him. The Crucifixion 32 As they went out, they found a man of Cyrene, Simon by name. They compelled this man to carry his cross. 33 And when they came to a place called Golgotha (which means Place of a Skull), 34 they offered him wine to drink, mixed with gall, but when he tasted it, he would not drink it. 35 And when they had crucified him, they divided his garments among them by casting lots. 36 Then they sat down and kept watch over him there. 37 And over his head they put the charge against him, which read, “This is Jesus, the King of the Jews.” 38 Then two robbers were crucified with him, one on the right and one on the left. 39 And those who passed by derided him, wagging their heads 40 and saying, “You who would destroy the temple and rebuild it in three days, save yourself! If you are the Son of God, come down from the cross.” 41 So also the chief priests, with the scribes and elders, mocked him, saying, 42 “He saved others; he cannot save himself. He is the King of Israel; let him come down now from the cross, and we will believe in him. 43 He trusts in God; let God deliver him now, if he desires him. For he said, ‘I am the Son of God.'” 44 And the robbers who were crucified with him also reviled him in the same way. The Death of Jesus 45 Now from the sixth hour6 there was darkness over all the land7 until the ninth hour.8 46 And about the ninth hour Jesus cried out with a loud voice, saying, “Eli, Eli, lema sabachthani?” that is, “My God, my God, why have you forsaken me?” 47 And some of the bystanders, hearing it, said, “This man is calling Elijah.” 48 And one of them at once ran and took a sponge, filled it with sour wine, and put it on a reed and gave it to him to drink. 49 But the others said, “Wait, let us see whether Elijah will come to save him.” 50 And Jesus cried out again with a loud voice and yielded up his spirit. 51 And behold, the curtain of the temple was torn in two, from top to bottom. And the earth shook, and the rocks were split. 52 The tombs also were opened. And many bodies of the saints who had fallen asleep were raised, 53 and coming out of the tombs after his resurrection they went into the holy city and appeared to many. 54 When the centurion and those who were with him, keeping watch over Jesus, saw the earthquake and what took place, they were filled with awe and said, “Truly this was the Son9 of God!” 55 There were also many women there, looking on from a distance, who had followed Jesus from Galilee, ministering to him, 56 among whom were Mary Magdalene and Mary the mother of James and Joseph and the mother of the sons of Zebedee. Jesus Is Buried 57 When it was evening, there came a rich man from Arimathea, named Joseph, who also was a disciple of Jesus. 58 He went to Pilate and asked for the body of Jesus. Then Pilate ordered it to be given to him. 59 And Joseph took the body and wrapped it in a clean linen shroud 60 and laid it in his own new tomb, which he had cut in the rock. And he rolled a great stone to the entrance of the tomb and went away. 61 Mary Magdalene and the other Mary were there, sitting opposite the tomb. The Guard at the Tomb 62 The next day, that is, after the day of Preparation, the chief priests and the Pharisees gathered before Pilate 63 and said, “Sir, we remember how that impostor said, while he was still alive, ‘After three days I will rise.' 64 Therefore order the tomb to be made secure until the third day, lest his disciples go and steal him away and tell the people, ‘He has risen from the dead,' and the last fraud will be worse than the first.” 65 Pilate said to them, “You have a guard10 of soldiers. Go, make it as secure as you can.” 66 So they went and made the tomb secure by sealing the stone and setting a guard. The Resurrection 28 Now after the Sabbath, toward the dawn of the first day of the week, Mary Magdalene and the other Mary went to see the tomb. 2 And behold, there was a great earthquake, for an angel of the Lord descended from heaven and came and rolled back the stone and sat on it. 3 His appearance was like lightning, and his clothing white as snow. 4 And for fear of him the guards trembled and became like dead men. 5 But the angel said to the women, “Do not be afraid, for I know that you seek Jesus who was crucified. 6 He is not here, for he has risen, as he said. Come, see the place where he11 lay. 7 Then go quickly and tell his disciples that he has risen from the dead, and behold, he is going before you to Galilee; there you will see him. See, I have told you.” 8 So they departed quickly from the tomb with fear and great joy, and ran to tell his disciples. 9 And behold, Jesus met them and said, “Greetings!” And they came up and took hold of his feet and worshiped him. 10 Then Jesus said to them, “Do not be afraid; go and tell my brothers to go to Galilee, and there they will see me.” The Report of the Guard 11 While they were going, behold, some of the guard went into the city and told the chief priests all that had taken place. 12 And when they had assembled with the elders and taken counsel, they gave a sufficient sum of money to the soldiers 13 and said, “Tell people, ‘His disciples came by night and stole him away while we were asleep.' 14 And if this comes to the governor's ears, we will satisfy him and keep you out of trouble.” 15 So they took the money and did as they were directed. And this story has been spread among the Jews to this day. The Great Commission 16 Now the eleven disciples went to Galilee, to the mountain to which Jesus had directed them. 17 And when they saw him they worshiped him, but some doubted. 18 And Jesus came and said to them, “All authority in heaven and on earth has been given to me. 19 Go therefore and make disciples of all nations, baptizing them in12 the name of the Father and of the Son and of the Holy Spirit, 20 teaching them to observe all that I have commanded you. And behold, I am with you always, to the end of the age.” Footnotes [1] 27:3 Greek he [2] 27:24 Some manuscripts this righteous blood, or this righteous man's blood [3] 27:26 A Roman judicial penalty, consisting of a severe beating with a multi-lashed whip containing embedded pieces of bone and metal [4] 27:27 Greek the praetorium [5] 27:27 Greek cohort; a tenth of a Roman legion, usually about 600 men [6] 27:45 That is, noon [7] 27:45 Or earth [8] 27:45 That is, 3 p.m. [9] 27:54 Or a son [10] 27:65 Or Take a guard [11] 28:6 Some manuscripts the Lord [12] 28:19 Or into (ESV)

Todd N Tyler Radio Empire
10/14 App 1 Hit By Hail

Todd N Tyler Radio Empire

Play Episode Listen Later Oct 14, 2021 8:25


The golf umbrella WILL protect you!See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Sluggo
E67: Hail to the Beef

Sluggo

Play Episode Listen Later Oct 14, 2021 47:23


The boys tear up the CFB landscape with a record setting 7-2 week, including a perfect 3-0 week from Beef. All 3 are now over .500 on the year. We'll look back at those picks and the bizarro week 6 of college football and then turn our focus to week 7. Strangely, there's a Friday night game in upstate New York that all three have some sort of wager on. Wonder what that could be. Twitter: @PodcastSluggo Facebook: Sluggo Podcast Instagram: Sluggo Podcast YouTube: Sluggo Podcast FB CFB Discussion: College Football (non-team specific) Discussion Group - 1,521 members strong! --- Send in a voice message: https://anchor.fm/sluggo-podcast/message

Off Course with Claude Harmon
Wayne Riley Interview: ‘Radar‘ from playing on Tour to on-course commentating, why so many great golfers hail from down under

Off Course with Claude Harmon

Play Episode Listen Later Oct 13, 2021 64:14


On this episode of GOLF's Off Course with Claude Harmon III, former Aussie professional and current Sky Sports commentator Wayne Riley joins and shares how he got the nickname 'Radar' from the hit show M*A*S*H. Radar discusses how he fell in love with the sport growing up down under, offers his take on why there are so many great Australian golfers and why we'll definitely see another player as dominant as Tiger Woods and Jack Nicklaus. Plus, Radar shares why it's such an honor to walk alongside the pros and talk about the great game of golf after playing professionally himself.

Jean & Mike Do The New York Times Crossword
Tuesday, October 12, 2021 - All Hail AMUNRA, God of Dubious Spelling!

Jean & Mike Do The New York Times Crossword

Play Episode Listen Later Oct 13, 2021 9:59


Today's crossword included the reappearance of 2D, Egyptian king of the Gods, AMNUNRA, whose alternative spellings are so legendary - AMUNRA, AMENRA, AMONRA , to name just three -- that he has earned the unofficial moniker, God of Dubious Spelling. The rest of the grid was entertaining, focused on the concept of 37A, Portmanteau coinage describing this puzzle's theme, ALLITERNATION. Examples of these include 17A, Game that has only a single round, RUSSIANROULETTE, 23A, Single item seemingly always found at the bottom of a McDonald's bag, FRENCHFRY (cute!), and 49A, Entrance divided in half horizontally, DUTCHDOOR. In other news, it's Triplet Tuesday, and Mike gets 2 out of 3, only striking out on DOW. To hear that and more, download and listen up!

Virginia Water Radio
Episode 598 (10-11-21): The Flu and Water

Virginia Water Radio

Play Episode Listen Later Oct 12, 2021


CLICK HERE to listen to episode audio (5:02).Sections below are the following: Transcript of Audio Audio Notes and Acknowledgments ImagesExtra Information Sources Related Water Radio Episodes For Virginia Teachers (Relevant SOLs, etc.). Unless otherwise noted, all Web addresses mentioned were functional as of 10-8-21. TRANSCRIPT OF AUDIO From the Cumberland Gap to the Atlantic Ocean, this is Virginia Water Radio for the week of October 25, 2021.  This revised episode from November 2017 is part of a series this fall of episodes on water connections to the human body and human biology. We start with a public health mystery sound.  Have a listen for about 35 seconds, and see if you can guess what seasonal, precautionary procedure is taking place.  And here's a hint: thinking feverishlycould influence your answer. SOUNDS and VOICES - ~36 sec “Any problems with any vaccines before?”“No.”“Feeling OK today?  No fever or anything like that?”“No.”“And no allergies to foods or medications that you're aware of?”“No.”  …“So, you know, a little bit of arm soreness; that's probably the most of it.  Redness, irritation.   Might be kind of tired for a day or so, or even a low-grade fever or a headache is possible and normal.  If that were to happen, whatever you take for a headache is fine.  Any questions about anything?”“No.”“All right.” …“All right, leave that bandage on for about 10 minutes or so, and take it off anytime you remember after that.  And here's your copy for your records.  Thanks.”“Thank you.”“Have a good day.”If you guessed, a flu shot, you're right!  You heard an influenza vaccination being given in October 2017 at Virginia Tech in Blacksburg.  Flu season arrives every year with colder weather, bringing the potential to cause fever, body aches, and other symptoms, some quite serious or even fatal.  The flu affects millions of people in the United States each year, and health agencies like U.S. Centers for the Disease Control and Prevention and the Virginia Department of Health encourage vaccination for everyone older than six months, with some exceptions. But what does the flu have to do with water?  Consider these three connections. First, drinking plenty of fluids is a commonly prescribed treatment for flu sufferers in order to help prevent dehydration resulting from increased body temperature and other responses to the viral infection.  Infants, children, and the elderly are particularly at risk for dehydration. Second, the flu virus is transmitted between humans by respiratory droplets, and researchers have found that transmission is affected by air temperature and humidity. Specifically, transmission occurs more easily in cold, dry air, such as is typically found during fall and winter in temperate areas like Virginia. Third, waterfowl and shorebirds are among the various kinds of birds that harbor avian flu viruses, and water contaminated with aquatic birds' waste can potentially harbor avian flu for some time.  Understanding the factors related to the occurrence and transmission of avian viruses—including the role of contaminated water—is important in monitoring avian flu and its potential to spread to other birds, mammals, or humans. Flu season is upon us, and the CDC recommends getting a flu vaccine by the end of October.  So if you hear this… VOICE - ~3 sec – “Are you here for a flu shot?” …now you'll have not only a health connection for the flu, but some hydrological ones, too. Thanks to staff of Kroger Pharmacy and Hokie Wellness for lending their voices to this episode. We close with some music for, or rather, against the flu.  Here's about 30 seconds of “Shots,” written by Wilson Stern and performed in a 2014, flu-shot-promoting video by the University of Florida's Student Health Care Center. MUSIC - ~28 sec Lyrics:“Last year less than half the population got their flu shot.  Why you wanna be stuck at home with a fever when you could be making this party hot?”“I heard that shot made you ill.”“Naw, son, that news ain't for real.  It tells your body what the virus looks like, so it knows how to deal”“Why you tellin' me this?  I got my flu shot last year.”“This virus mutates constantly, we got new strains here.”“Shots, shots, shots, shots….” SHIP'S BELL Virginia Water Radio is produced by the Virginia Water Resources Research Center, part of Virginia Tech's College of Natural Resources and Environment.  For more Virginia water sounds, music, or information, visit us online at virginiawaterradio.org, or call the Water Center at (540) 231-5624.  Thanks to Stewart Scales for his banjo version of Cripple Creek to open and close this show.  In Blacksburg, I'm Alan Raflo, thanking you for listening, and wishing you health, wisdom, and good water. AUDIO NOTES AND ACKNOWLEDGEMENTS This Virginia Water Radio episode replaces Episode 393, 11-6-17, which has been archived. The influenza vaccination heard in this episode was performed October 24, 2017, at Virginia Tech in Blacksburg, by staff of Kroger Pharmacies, assisted by staff from Virginia Tech's Hokie Wellness program.  Virginia Water Radio thanks those staff people for their willingness to be recorded. The audio excerpt of “Shots,” copyright by Wilson Stern, was taken from the 2014 University of Florida Student Health Care Center video “Flu Shots,” copyright by the University of Florida; used with permission of Wilson Stern and the University of Florida's Division of Media Properties.  The 2 min./4 sec. video is available online at http://shcc.ufl.edu/services/primary-care/flu/flu-shots-music-video-lyrics/.   More information about Wilson Stern and the group Hail! Cassius Neptune is available online at https://www.reverbnation.com/hailcassiusneptune.Click here if you'd like to hear the full version (1 min./11 sec.) of the “Cripple Creek” arrangement/performance by Stewart Scales that opens and closes this episode.  More information about Mr. Scales and the group New Standard, with which Mr. Scales plays, is available online at http://newstandardbluegrass.com. IMAGES Colorized, negative-stained transmission electron microscopic image of influenza virus particles, known as virions.   Public domain photo taken in 1973 by Dr. F. A. Murphy, accessed from the U.S. Centers for Disease Control and Prevention's Public Image Library, online at https://phil.cdc.gov/Details.aspx?pid=10072.Illustration of influenza infection, from the U.S. Centers for Disease Control and Prevention (CDC), “Images of Influenza Viruses,” online at https://www.cdc.gov/flu/resource-center/freeresources/graphics/images.htm.U.S. Centers for Disease Control and Protection weekly map of flu activity, as of 10/2/21.  Map accessed online at https://www.cdc.gov/flu/weekly/usmap.htm, 10/11/21.U.S. Centers for Disease Control and Prevention chart of work to develop the annual flu virus vaccine, with data for 2020-21.   Image accessed at https://www.cdc.gov/flu/resource-center/freeresources/graphics/infographics.htm. EXTRA INFORMATION ABOUT TYPES AND NAMES OF INFLUENZA VIRUSESThe following information is quoted from the U.S. Centers for Disease Control and Protection (CDC), “Types of Influenza Viruses,” November 18, 2019, online at https://www.cdc.gov/flu/about/viruses/types.htm.“There are four types of influenza viruses: A, B, C and D.   Human influenza A and B viruses cause seasonal epidemics of disease (known as the flu season) almost every winter in the United States.  Influenza A viruses are the only influenza viruses known to cause flu pandemics, i.e., global epidemics of flu disease.  A pandemic can occur when a new and very different influenza A virus emerges that both infects people and has the ability to spread efficiently between people.  Influenza type C infections generally cause mild illness and are not thought to cause human flu epidemics.  Influenza D viruses primarily affect cattle and are not known to infect or cause illness in people. ”Influenza A viruses are divided into subtypes based on two proteins on the surface of the virus: the hemagglutinin (H) and the neuraminidase (N).  There are 18 different hemagglutinin subtypes and 11 different neuraminidase subtypes (H1 through H18 and N1 through N11 respectively).  …Current sub-types of influenza A viruses that routinely circulate in people include: A (H1N1) and A (H3N2).  In the spring of 2009, a new influenza A (H1N1) virus emerged to cause illness in people. … “Currently circulating influenza A(H1N1) viruses are related to the pandemic 2009 H1N1 virus that emerged in the spring of 2009 and caused a flu pandemic ( see CDC 2009 H1N1 Flu website for more information).  This virus, scientifically called the ‘A(H1N1)pdm09 virus,' and more generally called ‘2009 H1N1,' has continued to circulate seasonally since then.  These H1N1 viruses have undergone relatively small genetic changes and changes to their antigenic properties (i.e., the properties of the virus that affect immunity) over time.“Of all the influenza viruses that routinely circulate and cause illness in people, influenza A(H3N2) viruses tend to change more rapidly, both genetically and antigenically. … “Influenza B viruses are not divided into subtypes, but instead are further classified into two lineages: B/Yamagata and B/Victoria. …Influenza B viruses generally change more slowly in terms of their genetic and antigenic properties than influenza A viruses, especially influenza A(H3N2) viruses.  Influenza surveillance data from recent years shows co-circulation of influenza B viruses from both lineages in the United States and around the world.  However, the proportion of influenza B viruses from each lineage that circulate can vary by geographic location.“CDC follows an internationally accepted naming convention for influenza viruses.  This convention was accepted by WHO [World Health Organization] in 1979 and published in February 1980 in the Bulletin of the World Health Organization, 58(4):585-591 (1980) (see A revision of the system of nomenclature for influenza viruses: a WHO Memorandum[854 KB, 7 pages]).  The approach uses the following components: *the antigenic type (e.g., A, B, C); *the host of origin (e.g., swine, equine, chicken, etc.; for human-origin viruses, no host of origin designation is given); *geographical origin (e.g., Denver, Taiwan, etc.); *strain number (e.g., 15, 7, etc.); *year of isolation (e.g., 57, 2009, etc.); *for influenza A viruses, the hemagglutinin and neuraminidase antigen description in parentheses (e.g., (H1N1). “One influenza A (H1N1), A (H3N2), and one or two influenza B viruses (depending on the vaccine) are included in each year's influenza vaccines.” SOURCES Used for Audio Antonia E. Dalziel et al., “Persistence of Low Pathogenic Influenza A Virus in Water: A Systematic Review and Quantitative Meta-Analysis,” PLOS One, 10/13/16, online at http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0161929.  Anice C. Lowen and John Steel, “Roles of Humidity and Temperature in Shaping Influenza Seasonality,” Journal of Virology, Vol. 88/No. 14, July 2014, pages 7692-7695; online at http://jvi.asm.org/content/88/14/7692.full (subscription may be required for access). Anice C. Lowen et al., “Influenza Virus Transmission Is Dependent on Relative Humidity and Temperature,” PLOS, 10/19/07, online at http://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.0030151. Public Library of Science, “Higher indoor humidity inactivates flu virus particles,” posted by Science Daily, 2/27/13, online at https://www.sciencedaily.com/releases/2013/02/130227183456.htm. David Robson, The Real Reason Germs Spread in Winter, BBC Future, 10/19/15. Jeffery K. Taugenberger and David M. Morens, “1918 Influenza: The Mother of All Pandemics,” Emerging Infectious Diseases (Center for Disease Control and Prevention), Vol. 12/No. 1, January 2006, online at https://wwwnc.cdc.gov/eid/article/12/1/05-0979_article. U.S. Centers for Disease Control and Prevention (CDC):“Chemical Disinfectants,” online at https://www.cdc.gov/infectioncontrol/guidelines/disinfection/disinfection-methods/chemical.html;“Flu Activity and Surveillance,” online at https://www.cdc.gov/flu/weekly/fluactivitysurv.htm(includes a weekly nationwide map of flu activity);“The Flu: Caring for Someone Sick at Home,” online (as PDF) at https://www.cdc.gov/flu/pdf/freeresources/general/influenza_flu_homecare_guide.pdf;“Flu Season,” online at https://www.cdc.gov/flu/about/season/flu-season.htm;“How Flu Spreads,” online at https://www.cdc.gov/flu/about/disease/spread.htm;“Influenza (Flu),” online at https://www.cdc.gov/flu/index.html;“Influenza in Animals,” online at https://www.cdc.gov/flu/other_flu.htm (information on flu in bats, birds, dogs, swine, and other animals);“Information on Avian Influenza,” online at https://www.cdc.gov/flu/avianflu/;“National Influeza Vaccination Week,” online at https://www.cdc.gov/flu/resource-center/nivw/index.htm;“Prevent Seasonal Flu,” online at https://www.cdc.gov/flu/prevent/index.html;“Who Should and Who Should NOT Get a Flu Vaccination,” online at https://www.cdc.gov/flu/prevent/whoshouldvax.htm. U.S. Environmental Protection Agency (EPA), Pandemic Influenza Fact Sheet for the Water Sector, 2009. Virginia Department of Health, “Epidemiology Fact Sheets/Influenza,” September 2018, online at http://www.vdh.virginia.gov/epidemiology/epidemiology-fact-sheets/influenza/. World Health Organization (WHO), “Influenza (Avian and other zoonotic),” November 13, 2018, online at https://www.who.int/news-room/fact-sheets/detail/influenza-(avian-and-other-zoonotic). For More Information about Water an

time health science bay university agency music current national natural earth home state audio college map accent animals dark surveillance tech human water web index rain united states pond research ocean weather government taiwan education public prevention vol voice illustration chesapeake snow environment journal types organisms display images skeleton persistence msonormal virology stream normal worddocument zoom donotshowrevisions citizens flu bacteria voices arial environmental temperature times new roman trackmoves trackformatting punctuationkerning saveifxmlinvalid ignoremixedcontent compatibility breakwrappedtables dontgrowautofit latentstyles deflockedstate latentstylecount latentstyles style definitions msonormaltable table normal donotpromoteqf lidthemeother lidthemeasian x none snaptogridincell wraptextwithpunct useasianbreakrules mathpr mathfont cambria math brkbin brkbinsub smallfrac dispdef lmargin rmargin defjc centergroup wrapindent intlim subsup narylim undovr defunhidewhenused defsemihidden defqformat defpriority lsdexception locked priority semihidden unhidewhenused qformat name normal name title name default paragraph font name subtitle name strong name emphasis name table grid name placeholder text name no spacing name light shading name light list name light grid name medium shading name medium list name medium grid name dark list name colorful shading name colorful list name colorful grid name light shading accent name light list accent name light grid accent name revision name list paragraph name quote name intense quote name dark list accent name colorful shading accent name colorful list accent name colorful grid accent name subtle emphasis name intense emphasis name subtle reference name intense reference name book title name bibliography name toc heading hail world health organization shots biology cdc lyrics civics grade nutrients public library docs colorful signature bio query flu season scales txt roles govt human body watershed transcript humidity toc naw passwords centers disease control virginia tech neurological ls atlantic ocean infants natural resources david m influenza grades k avian influenza science daily name normal indent name list name list bullet name list number name closing name signature name body text name body text indent name list continue name message header name salutation name date name body text first indent name note heading name block text name document map name plain text name e name normal web name normal table name no list name outline list name table simple name table classic name table colorful name table columns name table list name table 3d name table contemporary name table elegant name table professional name table subtle name table web name balloon text name table theme name plain table name grid table light name grid table light accent dark accent colorful accent name list table processes h1n1 bulletin blacksburg prevention cdc kb msohyperlink world health organization who sections life sciences stormwater david robson policymakers n1 bmp environmental protection agency epa n11 new standard acknowledgment muscular flu shots virginia department lowen cripple creek cumberland gap 7c sols plos one tmdl feeling ok bbc future john steel geological survey mayo clinic health system h3n2 plos who world health organization circulatory emerging infectious diseases living systems dalziel virginia standards water center redness space systems colorized relative humidity audio notes
Todd N Tyler Radio Empire
10/12 5-1 Hit By Hail

Todd N Tyler Radio Empire

Play Episode Listen Later Oct 12, 2021 21:05


It hurts!!!See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Distilled Discussions
Ep. 59 All Hail Fort Nelson!

Distilled Discussions

Play Episode Listen Later Oct 11, 2021 15:42


Andy and Jon discuss everything Michter's, Part II!

The Fire You Carry
058: Should You Quit Your Job? Encouragement For Those Who Might Be Terminated.

The Fire You Carry

Play Episode Listen Later Oct 11, 2021 41:05


In this episode, we have the return of Kevin & Nole, sans guest! We love guests but this week we felt it would be good to talk to those of you in the audience that may be facing the reality of being fired in the near future. While we do not get political on this podcast we did want to share some of our thoughts on how to look at the current challenge that so many are facing right now and give you a couple of different ways to look at it and hopefully work through it. We also delve into some reasons that you might decide it's time to quit your current job and we share our thoughts on that as well. As mentioned in the episode if you want to reach out and talk to us personally on this stuff you're welcome to do so, just join our Discord group via the link below. Thank you for listening.Huge thank you to Facedown Records and My Epic for the use of their song "Hail" in our podcast! https://www.youtube.com/watch?v=PE5wFemwai8&ab_channel=FacedownRecordsJoin our Discord! https://discord.gg/rkDa9Ae27qBuy a shirt!https://thefireyoucarry.threadless.com/Buy us a coffee!https://thefireyoucarry.threadless.com/

Shot of Wrestling
Episode 276: All Hail King Woods

Shot of Wrestling

Play Episode Listen Later Oct 11, 2021 92:14


Rob Williams from the Bob Culture Podcast joins us this week and together, we all put our heads together to see who we think deserves to be crowned King and Queen. Xavier Woods seems to have all the momentum but so did Liv Morgan. AEW unveiled the new TBS Championship, who should become the first woman to hold the new title? With AEW on the roll they are, should Vince WWE start to consider them real competition and if not now, when? Jeff Hardy hinted at a possible character change, could this help revive his career? --- This episode is sponsored by · Anchor: The easiest way to make a podcast. https://anchor.fm/app

Shot of Wrestling
Episode 276: All Hail King Woods

Shot of Wrestling

Play Episode Listen Later Oct 11, 2021 90:50


Rob Williams from the Bob Culture Podcast joins us this week and together, we all put our heads together to see who we think deserves to be crowned King and Queen.  Xavier Woods seems to have all the momentum but so did Liv Morgan.  AEW unveiled the new TBS Championship, who should become the first woman to hold the new title?  With AEW on the roll they are, should Vince WWE start to consider them real competition and if not now, when?  Jeff Hardy hinted at a possible character change, could this help revive his career?  

Shattered Cast Uncut
All Hail Unicron Episode 2: The Wrong Door Dashed

Shattered Cast Uncut

Play Episode Listen Later Oct 8, 2021 90:42


All Hail Unicron: Episode 2 INTRODUCTION Anybody Get Anything? Movie News Third party news TFC Toys (TF X Gi Joe) Dominator Megatron ​https://news.tfw2005.com/2021/10/04/tfc-toys-stc-02-tyrant-g-i-joe-x-transformers-dominator-megatron-color-prototype-442199 Color prototypes Moon Studio Trainbots https://news.tfw2005.com/2021/10/02/moon-studio-ms-01-dark-night-g1-getsuei-and-ms-02-ice-land-g1-yukikaze-color-prototypes-442073 Cang Toys Predaking Combined: https://news.tfw2005.com/2021/09/30/cang-toys-thunderking-g1-predaking-combined-mode-image-441999 Guess whos back? Back again..  https://news.tfw2005.com/2021/09/27/unique-toys-dark-of-the-moon-megatron-gray-prototype-441814 Official news: Masterpiece Shouki https://news.tfw2005.com/2021/10/01/takara-tomy-transformers-mpg-collection-masterpiece-shouki-color-images-442058 Golden disc Collection: https://news.tfw2005.com/2021/09/27/war-for-cybertron-golden-disk-collection-chapter-1-road-ranger-puffer-official-reveal-441835 https://news.tfw2005.com/2021/09/28/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-2-autobot-jackpot-with-sights-revealed-441885 https://news.tfw2005.com/2021/09/29/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-3-mutant-tigatron-revealed-441922 https://news.tfw2005.com/2021/09/30/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-4-terrorsaur-revealed-441974 Haslab Starsaber: https://news.tfw2005.com/2021/09/18/more-haslab-victory-saber-prototype-images-from-dallas-fan-expo-441326 TF Kingdom Slammer: https://news.tfw2005.com/2021/09/17/transformers-kingdom-deluxe-slammer-in-hand-images-441275 TF Minimates: https://news.tfw2005.com/2021/09/14/diamond-select-toys-transformers-minimates-series-1-in-package-image-441051#images Statue-ish News: Prime-1 Optimus Statue: https://news.tfw2005.com/2021/09/15/prime-1-studio-war-for-cybertron-optimus-prime-statue-official-gallery-product-information-441098 Super 7 Golden Lagoon  Optimus and Megatron https://news.tfw2005.com/2021/10/03/super7-reaction-target-exclusive-transformers-golden-lagoon-optimus-prime-and-megatron-revealed-442147 Discussion:   Questions: Email your questions to: Hailunicroncast@gmail.com  Special Shoutouts: Dustmightz for providing the beats for the theme song! Check the Realm of Collectors on Facebook! https://www.facebook.com/groups/realmofcollectors Everyone who followed us from Shattered Cast Uncut, we are grateful to each and everyone of you for joining us on this journey! Hosts: T2RX6 http://www.youtube.com/user/T2rx6 Mathew Deluxe Baldwin https://www.youtube.com/c/DeluxeBaldwin Oscar Alonso https://www.youtube.com/user/oscarnjboy Robert Duyjuy-sabado-gigante

Shattered Cast Uncut
All Hail Unicron Episode 2: The Wrong Door Dashed

Shattered Cast Uncut

Play Episode Listen Later Oct 8, 2021 92:46


All Hail Unicron: Episode 2 INTRODUCTION Anybody Get Anything? Movie News Third party news TFC Toys (TF X Gi Joe) Dominator Megatron ​https://news.tfw2005.com/2021/10/04/tfc-toys-stc-02-tyrant-g-i-joe-x-transformers-dominator-megatron-color-prototype-442199 Color prototypes Moon Studio Trainbots https://news.tfw2005.com/2021/10/02/moon-studio-ms-01-dark-night-g1-getsuei-and-ms-02-ice-land-g1-yukikaze-color-prototypes-442073 Cang Toys Predaking Combined: https://news.tfw2005.com/2021/09/30/cang-toys-thunderking-g1-predaking-combined-mode-image-441999 Guess whos back? Back again..  https://news.tfw2005.com/2021/09/27/unique-toys-dark-of-the-moon-megatron-gray-prototype-441814 Official news: Masterpiece Shouki https://news.tfw2005.com/2021/10/01/takara-tomy-transformers-mpg-collection-masterpiece-shouki-color-images-442058 Golden disc Collection: https://news.tfw2005.com/2021/09/27/war-for-cybertron-golden-disk-collection-chapter-1-road-ranger-puffer-official-reveal-441835 https://news.tfw2005.com/2021/09/28/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-2-autobot-jackpot-with-sights-revealed-441885 https://news.tfw2005.com/2021/09/29/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-3-mutant-tigatron-revealed-441922 https://news.tfw2005.com/2021/09/30/transformers-generations-war-for-cybertron-golden-disk-collection-chapter-4-terrorsaur-revealed-441974 Haslab Starsaber: https://news.tfw2005.com/2021/09/18/more-haslab-victory-saber-prototype-images-from-dallas-fan-expo-441326 TF Kingdom Slammer: https://news.tfw2005.com/2021/09/17/transformers-kingdom-deluxe-slammer-in-hand-images-441275 TF Minimates: https://news.tfw2005.com/2021/09/14/diamond-select-toys-transformers-minimates-series-1-in-package-image-441051#images Statue-ish News: Prime-1 Optimus Statue: https://news.tfw2005.com/2021/09/15/prime-1-studio-war-for-cybertron-optimus-prime-statue-official-gallery-product-information-441098 Super 7 Golden Lagoon  Optimus and Megatron https://news.tfw2005.com/2021/10/03/super7-reaction-target-exclusive-transformers-golden-lagoon-optimus-prime-and-megatron-revealed-442147 Discussion:   Questions: Email your questions to: Hailunicroncast@gmail.com  Special Shoutouts: Dustmightz for providing the beats for the theme song! Check the Realm of Collectors on Facebook! https://www.facebook.com/groups/realmofcollectors Everyone who followed us from Shattered Cast Uncut, we are grateful to each and everyone of you for joining us on this journey! Hosts: T2RX6 http://www.youtube.com/user/T2rx6 Mathew Deluxe Baldwin https://www.youtube.com/c/DeluxeBaldwin Oscar Alonso https://www.youtube.com/user/oscarnjboy Robert Duyjuy-sabado-gigante

Today in San Diego
October Storm Brings Hail, Lightning and Rain to San Diego, Gov. Newsom Declares State of Emergency Over O.C. Oil Spill Sports Arena Redevelopment Project Update

Today in San Diego

Play Episode Listen Later Oct 5, 2021 4:16


October Storm Brings Hail, Lightning, and Rain to San Diego, First Alert Forecast, Gov. Newsom Declares State of Emergency Over O.C. Oil Spill, Ramona Mother Arrested In Shooting, S.D. County Leaders Take On Misinformation, S.D. County Covid Lates, Sports Arena Redevelopment Project Update, and National Do Something Nice Day. See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Virginia Water Radio
Episode 597 (10-4-21): Anticipating Frost as Fall Settles In

Virginia Water Radio

Play Episode Listen Later Oct 4, 2021


CLICK HERE to listen to episode audio (4:08).Sections below are the following: Transcript of Audio Audio Notes and Acknowledgments Images Sources Related Water Radio Episodes For Virginia Teachers (Relevant SOLs, etc.). Unless otherwise noted, all Web addresses mentioned were functional as of 10-1-21. TRANSCRIPT OF AUDIO From the Cumberland Gap to the Atlantic Ocean, this is Virginia Water Radio for the week of October 4, 2021.  This week, we pause our series of episodes on water connections to the human body, to revisit an episode from fall 2017 that explores one of the hallmarks of the autumn season. MUSIC – ~ 11 sec – instrumental.Following the astronomical start of fall on September 22, this episode features a fiddle tune named for a water-related weather event that will mark a meteorological fall turning point when it occurs across the Commonwealth in October or November.  Have a listen to the music for about 25 more seconds. MUSIC - ~26 sec – instrumental. You've been listening to part of “Cold Frosty Morn',” performed here by the western Virginia band New Standard.  One of the consequences of fall's arrival is frost in the mornings and, eventually, a significant enough freeze to end of the growing season, when temperatures fall to about 28 degrees Fahrenheit or below.  That temperature typically occurs for the first time each fall in mid-to-late October in western Virginia, early-to-mid November east of the Blue Ridge, and mid-to-late November in some Virginia coastal areas.  Those predicted periods are based on historical records through 2010; the typical frost and freeze dates may be shifting as Virginia experiences climate change.Generally, frost forms when water vapor in the air contacts plants, windows, cars, or other solid surfaces that are at or below water's freezing point of 32 degrees Fahrenheit.  Some specific kinds of frost include radiationfrost, occurring when surface objects are cooled by radiating their heat; advection frost, occurring when surfaces are cooled by winds; and rime, a dense type of frost that forms when super-cooled liquid water in fog or clouds contacts solid surfaces, such as trees, radio towers, or ships on winter seas. Frost may seem far away on Virginia's often mild, early October days.   But to paraphrase a comment about truth from the poem “Birches,” by RobertFrost, frost-producing weather will soon break in with all of its matter-of-fact. Thanks to New Standard for permission to use this week's music, and we close with about 10 more seconds of “Cold Frosty Morn'.” MUSIC - ~12 sec – instrumental. SHIP'S BELL Virginia Water Radio is produced by the Virginia Water Resources Research Center, part of Virginia Tech's College of Natural Resources and Environment.  For more Virginia water sounds, music, or information, visit us online at virginiawaterradio.org, or call the Water Center at (540) 231-5624.  Thanks to Ben Cosgrove for his version of “Shenandoah” to open and close the show.  In Blacksburg, I'm Alan Raflo, thanking you for listening, and wishing you health, wisdom, and good water. AUDIO NOTES AND ACKNOWLEDGEMENTS This Virginia Water Radio episode repeats and replaces Episode 387, 9-25-17. The performance of “Cold Frosty Morn'” heard here is copyright by New Standard, from the 2016 album “Bluegrass,” used with permission. More information about New Standard is available online at http://newstandardbluegrass.com.  This music was used previously by Virginia Water Radio most recently in Episode 501, 12-2-19. Click here if you'd like to hear the full version (2 min./22 sec.) of the “Shenandoah” arrangement/performance by Ben Cosgrove that opens and closes this episode.  More information about Mr. Cosgrove is available online at http://www.bencosgrove.com. IMAGES Maps showing frost/freeze dates in the continental United States, based on data from 1980 to 2010.  Upper map: ranges of earliest dates of first 32°F freeze; middle map: range of median dates of first 32°F freeze; lower map: range of median dates of first 28°F freeze.  Images from the National Weather Service/Northern Indiana Forecast Office, “Frost and Freeze Information,” online at http://www.weather.gov/iwx/fallfrostinfo, accessed 10-4-21. SOURCES USED FOR AUDIO AND OFFERING MORE INFORMATION Deborah Byrd, “Equinox Sun is Over Earth's Equator on September 22,” EarthSky, Sept. 22, 2021. Robert Frost, The Poetry of Robert Frost, Edward Connery Lathem, ed., Holt, Rineheart and Winston, New York, 1969.  The quote to which this episode refers, from “Birches” on page 121, is the following: “But I was going to say when Truth broke inWith all her matter of fact about the ice storm….” Kenneth G. Libbrecht, “Guide to Frost,” online at http://www.its.caltech.edu/~atomic/snowcrystals/frost/frost.htm. National Weather Service, “Ice Storms,” online at https://www.weather.gov/safety/winter-ice-frost.National Geographic Society, “Frost,” online at https://www.nationalgeographic.org/encyclopedia/frost/. National Geographic Society, “The Rime of the Ancient Mariner,” online at https://www.nationalgeographic.org/media/rime-ancient-mariner/. National Weather Service, Baltimore/Washington Forecast Office, “Watch/Warning/Advisory Definitions,” online at https://www.weather.gov/lwx/WarningsDefined. Isaac W. Park et al., “Advancing frost dates have reduced frost risk among most North American angiosperms since 1980,” Global Change Biology 2021, 27: pages 165–176, accessed online at https://doi.org/10.1111/gcb.15380. Sarah Vogelsong, “Autumn's first frost is falling later. For farmers, the consequences are wide-ranging,” Virginia Mercury, Nov. 3, 2020. WeatherOnline, “Rime,” online at http://www.weatheronline.co.uk/reports/wxfacts/Rime.htm. RELATED VIRGINIA WATER RADIO EPISODES All Water Radio episodes are listed by category at the Index link above (http://www.virginiawaterradio.org/p/index.html). See particularly the “Science” and “Weather” subject categories. Following are links to some other episodes on frozen or freezing precipitation.Freezing rain, sleet, and snow – Episode 461, 2-25-19.Hail – Episode 362, 4-3-17.Ice – Episode 403, 1-15-18;  Episode 404, 1-22-18; Episode 406, 2-5-18; Episode 556, 12-21-20.Snow – Episode 300, 1-25-16; Episode 407, 2-12-18. Following are links to some other episodes related to fall. Fall migratory birds – Episode 183, 10-14-13; Episode 281, 9-14-15; Episode 335, 9-26-16.Tree colors and changes in fall – Episode 285, 10/9/15. FOR VIRGINIA TEACHERS – RELATED STANDARDS OF LEARNING (SOLs) AND OTHER INFORMATION Following are some Virginia Standards of Learning (SOLs) that may be supported by this episode's audio/transcript, sources, or other information included in this post. 2020 Music SOLs SOLs at various grade levels that call for “examining the relationship of music to the other fine arts and other fields of knowledge.” 2018 Science SOLs Grades K-3 plus 5: MatterK.4 – Water is important in our daily lives and has properties.2.3 – Matter can exist in different phases. Grades K-5: Earth and Space SystemsK.9 – There are patterns in nature.1.7 – There are weather and seasonal changes; including that changes in temperature, light, and precipitation affect plants and animals, including humans.2.6 – There are different types of weather on Earth.2.7 – Weather patterns and seasonal changes affect plants, animals, and their surroundings.4.4 – Weather conditions and climate effects on ecosystems and can be predicted. Grade 66.3 – There is a relationship between the sun, Earth, and the moon. Key ideas include6.6 – Water has unique physical properties and has a role in the natural and human-made environment.6.7 – Air has properties and the Earth's atmosphere has structure and is dynamic. Life ScienceLS.8 – Change in ecosystems, communities, populations, and organisms over time. Earth ScienceES.11 – The atmosphere is a complex, dynamic system subject to long-and short-term variations.ES.12 – The Earth's weather and climate result from the interaction of the sun's energy with the atmosphere, oceans, and the land. 2015 Social Studies SOLs Grades K-3 Geography Theme1.6 – Virginia climate, seasons, and landforms. Virginia's SOLs are available from the Virginia Department of Education, online at http://www.doe.virginia.gov/testing/. Following are links to Water Radio episodes (various topics) designed especially for certain K-12 grade levels. Episode 250, 1-26-15 – on boiling, for kindergarten through 3rdgrade.Episode 255, 3-2-15 – on density, for 5th and 6th grade.Episode 282, 9-21-15 – on living vs. non-living, for kindergarten.Episode 309, 3-28-16 – on temperature regulation in animals, for kindergarten through 12th grade.Episode 333, 9-12-16 – on dissolved gases, especially dissolved oxygen in aquatic habitats, for 5th grade.Episode 403, 1-15-18 – on freezing and ice, for kindergarten through 3rd grade.Episode 404, 1-22-18 – on ice on ponds and lakes, for 4ththrough 8th grade.Episode 406, 2-5-18 – on ice on rivers, for middle school.Episode 407, 2-12-18 – on snow chemistry and physics, for high school.Episode 483, 7-29-19 – on buoyancy and drag, for middle school and high school.Episode 524, 5-11-20 – on sounds by water-related animals, for elementary school through high school.Episode 531, 6-29-20 – on various ways that animals get water, for 3rd and 4th grade.Episode 539, 8-24-20 – on basic numbers and facts about Virginia's water resources, for 4th and 6th grade.

new york science bay university agency truth guide music ice robert frost natural earth state poetry audio college frost change accent dark north american tech water web air index fall rain united states pond research maps ocean weather government education park tree chesapeake snow environment images rime ancient mariner msonormal commonwealth generally stream normal worddocument zoom donotshowrevisions citizens arial environmental times new roman trackmoves trackformatting punctuationkerning saveifxmlinvalid ignoremixedcontent compatibility breakwrappedtables dontgrowautofit latentstyles deflockedstate latentstylecount latentstyles style definitions msonormaltable table normal donotpromoteqf lidthemeother lidthemeasian x none snaptogridincell wraptextwithpunct useasianbreakrules mathpr mathfont cambria math brkbin brkbinsub smallfrac dispdef lmargin rmargin defjc centergroup wrapindent intlim subsup narylim undovr defunhidewhenused defsemihidden defqformat defpriority lsdexception locked priority semihidden unhidewhenused qformat name normal name title name default paragraph font name subtitle name strong name emphasis name table grid name placeholder text name no spacing name light shading name light list name light grid name medium shading name medium list name medium grid name dark list name colorful shading name colorful list name colorful grid name light shading accent name light list accent name light grid accent name revision name list paragraph name quote name intense quote name dark list accent name colorful shading accent name colorful list accent name colorful grid accent name subtle emphasis name intense emphasis name subtle reference name intense reference name book title name bibliography name toc heading hail fahrenheit shenandoah bluegrass upper holt grade colorful signature national weather service blue ridge freezing watershed transcript earth sciences virginia tech ls anticipating atlantic ocean natural resources equator grades k national geographic society name normal indent name list name list bullet name list number name closing name signature name body text name body text indent name list continue name message header name salutation name date name body text first indent name note heading name block text name document map name plain text name e name normal web name normal table name no list name outline list name table simple name table classic name table colorful name table columns name table list name table 3d name table contemporary name table elegant name table professional name table subtle name table web name balloon text name table theme name plain table name grid table light name grid table light accent dark accent colorful accent name list table cosgrove msohyperlink advancing birches earthsky sections life sciences ben cosgrove stormwater policymakers msobodytext bmp new standard acknowledgment virginia department cumberland gap sols tmdl virginia standards settles water center kenneth g space systems audio notes
The Fire You Carry
057: Juan Huizar, From Picking Garlic At Age 9 In Central California To President Of Sage Real Estate.

The Fire You Carry

Play Episode Listen Later Oct 4, 2021 71:00


In this episode, we sit down with Juan Huizar. Juan's family is originally from Mexico, they made the move to the Central Valley of California when Juan was 4. Juan grew up with hard-working role models from his parents and began learning the benefits of that hard work at age 9 when he started picking garlic in the fields. He worked hard in school, got involved in wrestling, and carried on the family dream of education as he went off to college and graduated with a degree. Juan is now the President of Sage Real Estate out of Long Beach, is married, and has 2 daughters. This is a great story of a family's pursuit of the American Dream, don't miss it. Thank you to Facedown records and My Epic for the use of their song "Hail" in the show!https://www.youtube.com/watch?v=Dz2RZThURTUJuan's webinar he created for the listeners of this podcast that are interested in investing in real estate. https://www.sageregroup.com/buying-your-first-multifamily-property-or-apartment-building-a-guide-for-new-real-estate-investors/Watch this!https://www.youtube.com/watch?v=EGuxvGcXl5Q&t=31Buy us a coffee!https://www.youtube.com/watch?v=EGuxvGcXl5Q&t=31Buy a shirt!https://thefireyoucarry.threadless.com/Buy coffee from Fire Dept. Coffee and support us by using thefireyoucarry at checkout!https://www.firedeptcoffee.com/

Around The Ring
ATR 265: All Hail the King and G1 Climax UpdatesThis week, Justin and Steve talked about highlights from the PWX All Hail the King events, A

Around The Ring

Play Episode Listen Later Oct 4, 2021 84:39


This week, Justin and Steve talked about highlights from the PWX All Hail the King events, AEW, and some G1 Climax updates. They also discuss their top 5 WWE male wrestlers that they'd like to see sign to AEW.Please excuse the minor technical difficulties that occurred early on in the show.

Satanic Study Hall
Heal Thyself. Hail Thyself.

Satanic Study Hall

Play Episode Listen Later Oct 2, 2021 90:29


On this special edition of Satanic Study Hall, we are joined by Minister Joe Dee and Reverend Jon Eldritch of TST Sober Faction. Pull up a seat and join us as we learn about their personal journeys, struggles, triumphs, and the story behind how Sober Faction came to life. "Heal Thyself. Hail Thyself." - TST Sober FactionVisit the TST Sober Faction Website @ Sober Faction - The Satanic TempleCHECK OUT OUR WEBSITE! @ http://www.satanicstudyhall.comEmail us @ satanicstudyhall@gmail.comClick Here to become a supporter of our Patreon and get cool merch, Bonus Episodes, Behind The Scenes content, and more!Support the show (http://www.patreon.com/satanicstudyhall)

Plain Label Podcast
PLP – V4E56 – Plain Label Plexcast Part 7 – Faults & Personal Shopper

Plain Label Podcast

Play Episode Listen Later Oct 1, 2021 57:56


This week, Eric and returning co-host Rachel Szelag continue their conversation of the Plain Label Plexcast theme with a look at the films Hail, Caesar! & Ad Astra. Thank you for listening, join Eric and a special co-host next week as they begin a discussion on the Conjuring Universe with a look at the films: […]

Metal Nerdery
110: Metal Soundtracks

Metal Nerdery

Play Episode Listen Later Sep 30, 2021 86:35


There was a time when Movie SOUNDTRACKS basically sucked and the only thing that could make them even remotely palatable was the inclusion of a Metal band, really any metal band!  (Obviously NOT Europe!).  Thankfully, we now live in the modern age, where it's not uncommon to see bands like Slayer and Pantera included on a moving picture soundtrack. (And as you'll soon discover, bolth bands have actually been on several soundtracks, and actually on one together!!!) Time to corral your free-range “pre-steak”, find out the answer regarding “Greg's” whereabouts, butter up the relaxer-infused jerky-flavored popcorn and get ready to JOIN US for some fuun, as we indulge in the “sultry sounds of nice” and stroll through the realm of METAL SOUNDTRACKS.    Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Can't be LOUD Enough Playlist on Spotify   Show Notes: (00:01) - #thesultrysoundsofniceASMR #Fuun #holdup #ohfuck / ***WELCOME BACK to the #MetalNerderyMetalverse !!!*** Intros and #pleasantries and #nonesuch #thisepisodes #beeroftheepisode #thisepisodesbeeroftheepisode #thisone #intuitive and #clear #again #PontoonBrewing #AlexOoohOfApproval #thisparticularepisodesbeerofthisepisode #PontoonBrewing (said that earlier…) #slam #CrushingWaves #WhhheatBeer #WhhhhaitWhhhhat? and also a #WheatBeer  #grassyass #mids #beatsbydre #freeplug #yourwelcome ***#albumcover #description in a #nutshell #rhymes with #MetalNerderyHQ33rdFloorInvertedUndergroundBunkerPoonStudios #tartsalivationASMR #notchunky / a #messenge but first a #klinky or a #halfklinky or a #klinkyandahalf (#MetalNerderyMessenge, Pt. 1)   (04:00) – Soundtracks, movies, and Metal (especially when soundtracks had METAL! #MetalNerderyBurpCoreASMR) / #fasttimesatridgemonthigh #MikeDamone #sidetwoofledzeppelinfour #wrongsong and a #tangentional #familyguymoment #breakfastcandles /#mainstreamocity of Metal on a soundtrack used to be #rare…and #treasured / Early #soundtrack #memories (#MaximumOverdrive #ACDC and #WhoMadeWho #originalsoundtrackalbum #overtangentionalled) #theydidscore / Some other #significant #Metal #contributions to #soundtracks including #Slayer #covertunehatred #burpfadeoutASMR #FFS #turnitoffnow / ***Whenever #metal was on a #soundtrack it was cause for #celebration and #rejoicing and also a #verybigdill #waitwhat #ididnteventhinkaboutthehelmet although #ilovethehelmet #contradiction #recordscratch*** A brief trip down the rabbit hole of #metalsoundtracks #metalsoundtrackASMR and #fuun in #Angerland #bigdill #bolth #backintheday   (11:42) - #thetitleytrack #Biohazard and #Onyx JUDGMENT NIGHT #judgmentnight (the #originalmotionpicturesoundtrack for the film Judgment Night) / #justamoment ANOTHER BODY MURDERED #MikePatton and #BooYaaTRIBE #publicenemyesque #minisoundtrackalbumdive / #yougottaplayTheHelmet #Helmet #ilovethehelmet #drillsolo #ting #loveit JUST ANOTHER VICTIM #pitchshiftedtimetravellingtriggery / #Pinche #Slayer and #IceT DISORDER #fuckingSlayer #FuckingSlayerASMR #wedontneedyourwar #thankyouandfuckoff #fuun   (16:34) – Heavy Metal-The Movie (#circa1981) #gambling #preMetal #SammyHagar #titleetrack #uhhyeah #VeryPriest #precomemetal #donaldfagen (***#SteelyDan was the #correctanswer***) / #BlackSabbath THE MOB RULES (“If you listen to fools…”) #BlackSabbathTrumpsEverything  #TonyIommiForPresident (or even also #MattPikeForPresident) #makingupforitintheshownotesASMR #GodBless #MetalManifesto #episode110 / #burpbelchingmaniaASMR / #CannibalCorpse HAMMER SMASHED FACE (from Ace Ventura Pet Detective) #excuseme #isGregHere? #thankyou #AceVenturaPetDetective #nevergetsold #newfoodgenre #spiderconspiracyASMR #spiderpropaganda #uhhhYeahhh   (22:20) – The Crow #thesomething #PanterA ***NOT #the #vadge (#RespectTheBadgina #RespectTheVadge) but also #TheBadge or #TheBadgina*** #thereitis / ***And now, Ladies and Gentlemen, Mr. Tom Morello*** #eembahbahbah #justataste of #jazzyshred #guitarsolo with #flava #TomMorelloGuitarSolo #veryfuckingcool #Moes #TheVoicemailSegment ***GIVE US A CALL AND LEAVE US A VOICEMAIL AT 980-666-8182***/ DARKNESS #RageAgainstTheMachine #RATM #waitforit #fastfingers and #extremelytasteful***Is the #vadge out?  #Pantera covering THE BADGE by #PoisonIdea (still from The Crow #originalmotionpicturesoundtrackalbumrecordingsongcontribution #PanterAized #weight / #ahnold #impression #notreally #heavymetty #vettyheavymetty / #amomentoftirade #regarding #backintheday   (28:42) – A #Revelation from Russell that sounds like it's 40 years old, but it's actually not…and a moment of #tangentionalalityismness to the 90's (see also #DaveJerden #AIC and #Anthrax for related #tangentionalality) #everyonechangedinthe90s / A “cow” equals  #presteak #Gertrude #freeplug from #TheRibLounge from #RonAtTheRibLoungeOfficial #neverseentit #episodederailmentASMR and #math #itswhatido ***metalnerdery@gmail.com #9806668182ASMR #GeoffTaintASMR  / #theoriginalmotionpicturesoundtrackalbumsongtrackthing from #stillFreddyVsJason Freddy Vs Jason and a #verynecessary #tangentional #notthat #ultratangentional #blackalbumreference #twelveyearsafter #blowoutthelines / #sparktical #Sepultura with #MikePatton THE WASTE ***See also #MrBungle…basically, Mike Patton + Any Band = a new version of Mr. Bungle*** #readthoselyrics #heedthoselyrics / To Mike:  #hail and #bewell / #Isolation and a #tangentional reference back to #Sepultura (and #Quadra)    (35:25) – Demon Night (#originalmotionmoviepicturesoundtrackalbumrecordsongcontributionASMR) and #TheMatrix #ThePunisher and the #AlexOoohOfApproval #regarding #Slayer and #Hatebreed and various, lesser mentioned soundtracks and a personal tangentional moment of 90's #alternativemetal and some #tangentional #idonthatepussy #BushHate #overrated #youractingsuckstoobutnotasmuchasyourband  #passiveaggressiveASMR / #inwardburp #notfdaapprovedASMR #HeyManNiceShot / “The Spawn” #originalmovingmotionpicturemusicsoundtracktacticalsongobligation #WaitWho #Dreadful #SimplyDreadfulASMR (***It was #EVH not #MJ***) #Slayer and #AtariTeenageRiot NO REMORSE (I WANNA DIE) #hateitalready #fuckthat   (41:08) - Rivers Edge #RiversEdge #backhanded #itsnotashittymovie #itsgreatbutitsucks #HallowsEve LETHAL TENDENCIES (from the #ATL!!!) #beforetheywerestars #whatsthecrazyguy #mostofthemare #weirdfeeling #WREKage #flashback / #SlayerizeMe with some #Slayer #MCTentacleChoice EVIL HAS NO BOUNDARIES #ifeelbetternow #tingly #itsmarked   (46:33) – The #anonymous #Angerman and the opposite of #fuun is #evil / #ballz #adifferentkindofexcitermoment #andthereitis (***the #actual track was #TrickOrTreat which is a #killeropener***) / #overrelaxered #medicateddemons / Strangeland (the motion picture soundtrack album release thing) #Soulfly EYE FOR AN EYE #grunt #standby for #tentacledifficulties #seewhatIdidthere? / ***PLEASE PAY ATTENTION FOR THIS NEXT PART OF THE SHOW!!!*** #thishalfoftheepisodesthisbeeroftheepisode #thesecondhalfoftheepisodesbeerofthispartoftheepisode #theconclusionbeeroftheepisode #alsoPontoonBrewing WAKE ZONE #pellell see also a #paleale #thatthingisstickingup #WakeZone #markthetime #manbeer #PontoonBrewing #yourewelcome #russellburpASMR #totallyRussell #burnedmyeyesalittle EYE FOR AN EYE #primal #tribal #pribal #trimal #boLth #technicolorformusic see also #chromesthesia   (54:03) – Dracula 2000 (#uhhyeah) #SystemOfADown covering METRO by #Berlin and a #debatablemoment as to whether or not #SOAD would classify as #SkaThrash in terms of #genre and #wishingyoueverysuccess / AVOID THE LIGHT by #PanterA #greatesttits #yesplease #creepysoftintro (not the song but the band…) #Inslomo #lastsecond #wordplay #hahaha #irony #derpyderp See also #ReinventingTheMetal #cantbeloudenough #CBLE #goodone #onmicburpclubdubburpbassASMR   (1:01:50) – The movie from 1985 “Demons” (#notNightRanger #backingup) ***Pretty Maids #PrettyMaids – I mean it ain't no #RickSpringfield but it's close!***  (#pleasantlysurprised) and an #offtopic moment regarding #BillyIdol and that change from hard rock to more of a #metal sound #devilish It's #NOT #NightRanger its NIGHT DANGER #biggamble #areyouscared #talkyburp and #Doro #nicetoseeya #toseeyanice #burn from the #boozemaiden #saywhen #imgoodbabe #thisbetterbegood #itsallonme #redemption #definitelymetal #tentativetentacles NIGHT DANGER by #PrettyMaids and footage from #EvilDead #gropedbygreenery in the #musicvideo (***see also Tree “R-Word” Scene***#iykyk #NotTheTreeRWord #NotTreeR_d  #foliagefondling #treelove #theXword #tentacleovertime   (1:08:30) – From the soundtrack of #MaximumOverdrive and #ACDC DT #instrumental / ***picking back up from the earlier #messenge…#pleasehold… (#MetalNerderyMessenge, Pt. 2) #reallylong #TheMarkOfCain from #Australia is in a potentially similar vein as #TheHelmet.  The song is called:  TELL ME #notlive #sleepyballs #necessary #longintro #quitegood / A various other assortment of other bands and/or soundtracks and also/or #loans and #raingers or #lone #rangers #lonerangers #lonesrangers #bolth #noigetit #noteven #whocaresaboutEnglish #loopholegenre #noderp   (1:14:50) - #TenaciousD “The Pick of Destiny” ^ #ithinkitis #imdefinitelyprettysure KICKAPOO and #futuresteak #yeah***go watch the video…AND go watch the movie! *** #seekthestrawberryriver #jaybels #doublethemetal    (1;19:38) - The Punisher #Slayer #because #FuckingSlayer and #uhhyeahhh THE FINAL SIX ***send someone some #tentaclelove #today*** #notthefinalcountdown #ultraderpASMR #STFU THE FINAL SIX (because maybe you forgot about that part if your #adderall and/or #relaxers isn't and/or aren't working) #SlayerIsABlessing #feelingbetteralready from #boLth #ThePunisherSoundtrack and the #ChristIllusion album. #blessin #ilikeitalot / Perhaps a single volume for a multi-installment series…***THANK YOU FOR LISTENING TO AND SUPPORTING THE METAL NERDERY PODCAST!!!*** / #untilthenext #softoutro #andthereitis #GeezahTheButlah #buyourshit at metalnerdery.com/merch  #outofcontrol #waitWTF #holywhatthefucktitudeBatman #itsallbullshit #theresnomoon #educationalpurposes #thebadgina ^ - We at Metal Nerdery 33rd Floor Inverted Underground Bunker Poon (I.U.B.P.) Studios in the beautiful, lovely, and talented (and shaved) area of downtown Atlanta, Georgia, feel that we would be terribly remiss in our capacity as a Metal-centric podcast if we were to fail to include Tenacious D in the greater metropolitan pantheon of Metal Podcastery.     Also…We're assuming (really kind of praying…) that you can actually read and that you actually take the time to look at this ridiculousness.  We sincerely hope you can read.  If you can, in fact, read, we also hope that you'll help someone else to learn “how to read” and talk good.  If you've read this far, know that we heart you and THANK YOU SO MUCH for your listenership and continued support!!!  #HAIL to #RonnieJamesDio, to #MeatLoaf and to #YOU!!!  

Ballad of the Seven Dice
Act III Chapter III - All Hail Prince M‘zi Part 2

Ballad of the Seven Dice

Play Episode Listen Later Sep 29, 2021 54:57


Welcome to Ballad of the Seven Dice. Just a heads up dear listeners, we discuss a recent review in the first twelve mins of the episode, and then the episode starts at 12:06. We here at Ballad feel these kind of things are important to discuss and even though this conversations can be uncomfortable, we should have them to help educate others and empathize with our fellow human beings who are suffering. Today's episode feature's M'zi once more in the city of Tul'nareth where he now talks to the Hive and tries to figure out what is really going on.   Ballad Theme, Inn of the Seven Dice - Dave Cole  Graham Plowman - The Great Old Ones and Other Beings - 06 The Black Goat of the Woods    Hyperfun, Long Note Two - Kevin Macleod Link: https://incompetech.filmmusic.io/  License: http://creativecommons.org/licenses/by/4.0/  Moving Clouds, Sings in the Fields - Rafael Krux Link: https://incompetech.filmmusic.io/  License: http://creativecommons.org/licenses/by/4.0/   

Fox Sports Radio Weekends
Straight Fire w/ Jason McIntyre - Jimmy G is JAG, the Rams are the Class of the NFC & All Hail Justin Herbert

Fox Sports Radio Weekends

Play Episode Listen Later Sep 27, 2021 50:08


On today's episode, Jason kicks things off with a deep dive into the Green Bay Packers thrilling Sunday night victory over the San Francisco 49ers. Aaron Rodgers did what Rodgers does, but the real story to come of this game was the play of the much-maligned Jimmy Garoppolo. It's hard to kill Jimmy G considering he put the 49ers in position to win the game with :37 left, but it's also hard to praise him considering he was just okay most of the night. Jimmy G isn't going to make you great, but he's definitely good enough to win. The only question at this point is who he'll be playing for next year because it darn sure won't be San Francisco (Maybe Pittsburgh or Miami?). Sticking in the NFC West, Matthew Stafford has absolutely unlocked the Sean McVay offense for the Los Angeles Rams. Jason tried to tell you when the Stafford trade went down that it made the Rams the Super Bowl favorites, and after the way they handled Tom Brady and the Buccaneers on Sunday, it's hard not to feel the same way today. Not to be outdone, Justin Herbert and the Los Angeles Chargers put the rest of the League on notice when they beat the Chiefs on Sunday. Herbert is arguably the most talented young quarterback in football outside of Patrick Mahomes, and he should be in the NFL MVP race this year and for years to come. Finally, Jason closes the show with a very special Monday Night Football (Philadelphia Eagles vs Dallas Cowboys) edition of the Best Bet. Click here to subscribe, rate and review all of the latest Straight Fire with Jason McIntyre podcasts! Learn more about your ad-choices at https://www.iheartpodcastnetwork.com

Straight Fire with Jason McIntyre
Jimmy G is JAG, the Rams are the Class of the NFC & All Hail Justin Herbert

Straight Fire with Jason McIntyre

Play Episode Listen Later Sep 27, 2021 50:08


On today's episode, Jason kicks things off with a deep dive into the Green Bay Packers thrilling Sunday night victory over the San Francisco 49ers. Aaron Rodgers did what Rodgers does, but the real story to come of this game was the play of the much-maligned Jimmy Garoppolo. It's hard to kill Jimmy G considering he put the 49ers in position to win the game with :37 left, but it's also hard to praise him considering he was just okay most of the night. Jimmy G isn't going to make you great, but he's definitely good enough to win. The only question at this point is who he'll be playing for next year because it darn sure won't be San Francisco (Maybe Pittsburgh or Miami?). Sticking in the NFC West, Matthew Stafford has absolutely unlocked the Sean McVay offense for the Los Angeles Rams. Jason tried to tell you when the Stafford trade went down that it made the Rams the Super Bowl favorites, and after the way they handled Tom Brady and the Buccaneers on Sunday, it's hard not to feel the same way today. Not to be outdone, Justin Herbert and the Los Angeles Chargers put the rest of the League on notice when they beat the Chiefs on Sunday. Herbert is arguably the most talented young quarterback in football outside of Patrick Mahomes, and he should be in the NFL MVP race this year and for years to come. Finally, Jason closes the show with a very special Monday Night Football (Philadelphia Eagles vs Dallas Cowboys) edition of the Best Bet. Learn more about your ad-choices at https://www.iheartpodcastnetwork.com

The Fire You Carry
056: John Schaefer, Dealing With The Loss Of The Job You Worked For All Your Career, Balancing Work Goals & Family Life & What To Do When You Reach Retirement Age.

The Fire You Carry

Play Episode Listen Later Sep 27, 2021 95:45


In this episode, we are joined once again by John Schaefer who was last with us on episode 39. This conversation hinges on John's lifelong pursuit of being Chief of Police, which he eventually attained and then subsequently lost. John is candid about the sacrifices made to obtain the career he had and the impact getting and then losing the position had on his family and himself. He also talks about how he looks at life after reaching retirement age and how he thinks we as a nation have gotten that wrong. This episode has lots of great life lessons and wisdom, don't miss it! Big thank you to My Epic and Facedown Records for the use of their song "Hail" in the podcast. https://www.youtube.com/watch?v=Dz2RZThURTUBuy us a coffee! https://www.buymeacoffee.com/TheFireYouCarrySupport the podcast and buy your coffee from Fire Dept. Coffee, use our code thefireyoucarry at checkout. https://www.firedeptcoffee.com/Buy a shirt!https://thefireyoucarry.threadless.com/Join our Discord group!https://discord.gg/2AyPQSzZ6d

Beers, Beats, and Balls | Fantasy Football Podcast

Kyle and Kory Join Brian in the D.P.A. to catch up with what has happened since their last visit.  They go over  BDP and Bed Poopers, talk about NFL news, and give their sidepiece updates.  Music by Avenged Sevenfold, Logic

Salty Nerd Podcast
SNP Weekly 96: Bruce Campbell Movies - Sundown, Assault On Dome 4, Bubba Ho-Tep

Salty Nerd Podcast

Play Episode Listen Later Sep 24, 2021 89:07


Hail to the king, baby! In this episode, the Nerds get all groovy with everyone's favorite B-movie actor, Bruce Campbell, as they take on some of his non-Evil Dead movies. The first is the vampire western Sundown: The Vampire In Retreat. Then there's the sci-fi Die Hard rip-off, Assault on Dome 4. Finally, it's the old Elvis vs. hillbilly mummy movie, Bubba Ho-Tep. Don't miss out on the fun! This is one episode you're going to want to check out!If you want more exclusive, awesome episodes of the Salty Nerd, check out our members area and get tons of ad-free episodes just for our wonderful members here: http://www.saltynerdclub.com

Shattered Cast Uncut
Shattered Cast Uncut Episode 381: ALL Hail Unicron (All Hail Unicron Episode 1)

Shattered Cast Uncut

Play Episode Listen Later Sep 24, 2021 84:00


PLEASE Subscribe to our NEW Youtube Channel: https://www.youtube.com/channel/UCKCxRpxGI87-LONU5l_8-rQ   Youtube Link For The Current Episode: https://youtu.be/Ctnu78zu6dg   All Hail Unicron: Episode 1 INTRODUCTION Anybody Get Anything? Movie News Third party news DNA Design MPM-12 Optimus Upgrade https://news.tfw2005.com/2021/09/17/dna-design-dk-27-upgrade-kit-for-masterpiece-movie-mpm-12-optimus-prime-441254 XTB Inferno, Grapple, Artfire and Hauler: https://news.tfw2005.com/2021/09/14/x-transbots-mx-v-dante-mx-vi-da-vinci-mx-vii-tirador-color-renders-masterpiece-scale-g1-inferno-grapple-artfire-441030 https://news.tfw2005.com/2021/09/15/x-transbots-mx-xxxv-caravaggio-masterpiece-scale-g1-hauler-color-renders-441173 Alien Attack Megatron: https://news.tfw2005.com/2021/09/15/alien-attack-toys-aat-01-mackron-dark-of-the-moon-megatron-color-prototype-44105783 Official news: Haslab Starsaber: https://news.tfw2005.com/2021/09/18/more-haslab-victory-saber-prototype-images-from-dallas-fan-expo-441326 TF Kingdom Slammer: https://news.tfw2005.com/2021/09/17/transformers-kingdom-deluxe-slammer-in-hand-images-441275 TF Minimates: https://news.tfw2005.com/2021/09/14/diamond-select-toys-transformers-minimates-series-1-in-package-image-441051#images Statue-ish News: Prime-1 Optimus Statue: https://news.tfw2005.com/2021/09/15/prime-1-studio-war-for-cybertron-optimus-prime-statue-official-gallery-product-information-441098   Discussion:   Questions: Hosts: 1.  T2RX6 http://www.youtube.com/user/T2rx6 2.  Mathew Deluxe Baldwin https://www.youtube.com/c/DeluxeBaldwin 3.  Oscar Alonso https://www.youtube.com/user/oscarnjboy 4. Robert Duyjuy-sabado-gigante

Behind The Boots - Stories by Veterans for Veterans

We're taking back ice cold Truepenny Pilsners from none other than Allagash which comes to us from Maine… with love. I know it sounds like an oxymoron, but we're heading to Air Force basic training in a high flying edition of Boot Camp Battles. We find out how not to tip a stripper in Rogue Privates get taken on a typical evening in the barracks in Barracks Life. Finally, someone gets a bad case of the bubble guts in Mail Call. Catch all this and so much more in this week's episode of Behind The Boots Help Antonio Fight Rare Cancer GoFundMe - https://www.gofundme.com/f/help-antonio-fight-rare-cancer?qid=5d207202b022dfd333acf34f8a1d3d45 Stay up to date with all of Jon & Bobby's latest stories by watching the full Behind The Boots Podcast. LIVE! Thursdays @ 12:00PM (EST)! Follow the Behind The Boots Podcast on Instagram: @BTBootsPodcast Follow WillCo Media on Instagram: @WillCo_Media SUBMIT YOUR STORIES AT THE LINK BELOW! www.WillCoMediaPro.com/BTBPodcast #BehindTheBoots #MilitaryPodcast #ByVetsForVets --- Support this podcast: https://anchor.fm/behind-the-boots/support

Stays Krunchy In Milk
Stays Krunchy in Milk Episode 411: Porn Angle Drones

Stays Krunchy In Milk

Play Episode Listen Later Sep 23, 2021 142:19


Hail, hail the gangs all here! You get a full complement of hosts this go round. We start matters off with a music discussion. Where, if I may ask, do you discover new music? Music transitions to shoes, and poorly crafted jokes. We read some news stories and punch up some headlines including Afghan refugees coming to NE Ohio. A Florida chiropractor signing Mask exemptions. A Michigan man is suing his school district after they his multi racial daughter's hair without parental permission. College students have drunk less during the pandemic but are experimenting more with drugs. Ant may have finally had his fill of Kanye's bullshit. Ant's boys have returned to school and they are all making the needed adjustments. Tee shares a tale of his father and the Scholastic Book Fair. Dan took a road trip to Kansas City. He shares the tales of his adventures. Gabe continues prepping for the Great Road Trip but we took the sharpest turn into a discussion on pornography production just as he began telling us about what's new. We do get back to Gabe's Road trip prep talk, but still, you needed to be prepared for the twists and turns. We wrap it up with a return to Reddit and some more AITA. Tatum l TAYREL713 l Lunchbox l Gabe LISTEN l RSS l Apple Podcast l Google Podcast l Spotify l TuneIn l Twitter l Amazon Music I YouTube l Twitch l Stitcher l Email l Amazon Wish List l Merch l Patreon I Rate This Podcast PHONE l 216-302-8763   #Cleveland #Ohio #Podcast #LiveFromThe216 #GhostfaceKillah #Nutmeg #Music #Shoes #SNKRS #AfghanRefugees #Chiropractic #Drugs #Alcohol #KanyeWest #Andre3000 #Okayplayer #BackToSchool #ScholasticBookFair #Memories #KansasCity #Chiefs #Browns #NFL #Drones #VR #4K #Playlists #DissrespectfulJams #Reddit #AITA

On The Warpath
Measuring Stick vs. Dip Sticks w/ Parker Hamlett (WFT vs. Buffalo Preview)

On The Warpath

Play Episode Listen Later Sep 23, 2021 69:29


Parker Hamlett of Sidelines Washington stops by to recap WFT's Thursday night victory against the Giants and preview the road opener at Buffalo. Subscribe to Sidelines Washington: https://www.youtube.com/channel/UCiGlNNoaTEe9FnFLfu4VvLQ Follow Parker on all platforms: @parkerhamlett Follow Sidelines Washington: @Sidelines_WFT Download the RaveOnSports App: Apple: https://apps.apple.com/us/app/raveon-sports-fans-be-heard/id1485694074 Google Play: https://play.google.com/store/apps/details?id=com.app.android.badcall&hl=en_US&gl= Like Us on Facebook at https://www.facebook.com/OnTheWarpath... Check out the On The Warpath Podcast https://anchor.fm/onthewarpath #WashingtonFootballTeam #WASvsBUF #BuffaloBills #HTTWFT #WFT #Redskins #NFL #NFC #NFCEAST #RedskinsNews #Football #NFLNews #GoRedskins #WashingtonRedskins #AmericanFootball #Youtube #WashingtonFootball On The Warpath is hosted by Corey "Sanchize405" Sanchez. We discuss all things Washington Football along with news across the NFL. Our goal is to inform and entertain. If you like what you see click subscribe. Love, peace, and HAIL! Be sure to follow me on Twitter @Sanchize405 Follow me on Instagram @Sanchize405 P.O. Box Address: Corey Sanchez P.O. Box 2343 Wise, Virginia 24293-2343 If you would like to donate to the channel: Paypal: PayPal.Me/sanchize405 Venmo: @sanchize405 Cash App: $sanchize405 Please send email inquiries to coreysanchez405@gmail.com Thank you for supporting the channel!

ESV: Through the Bible in a Year
September 22: Ecclesiastes 4–6; Psalm 77; John 19

ESV: Through the Bible in a Year

Play Episode Listen Later Sep 22, 2021 32:22


Old Testament: Ecclesiastes 4–6 Ecclesiastes 4–6 (Listen) Evil Under the Sun 4 Again I saw all the oppressions that are done under the sun. And behold, the tears of the oppressed, and they had no one to comfort them! On the side of their oppressors there was power, and there was no one to comfort them. 2 And I thought the dead who are already dead more fortunate than the living who are still alive. 3 But better than both is he who has not yet been and has not seen the evil deeds that are done under the sun. 4 Then I saw that all toil and all skill in work come from a man's envy of his neighbor. This also is vanity1 and a striving after wind. 5 The fool folds his hands and eats his own flesh. 6 Better is a handful of quietness than two hands full of toil and a striving after wind. 7 Again, I saw vanity under the sun: 8 one person who has no other, either son or brother, yet there is no end to all his toil, and his eyes are never satisfied with riches, so that he never asks, “For whom am I toiling and depriving myself of pleasure?” This also is vanity and an unhappy business. 9 Two are better than one, because they have a good reward for their toil. 10 For if they fall, one will lift up his fellow. But woe to him who is alone when he falls and has not another to lift him up! 11 Again, if two lie together, they keep warm, but how can one keep warm alone? 12 And though a man might prevail against one who is alone, two will withstand him—a threefold cord is not quickly broken. 13 Better was a poor and wise youth than an old and foolish king who no longer knew how to take advice. 14 For he went from prison to the throne, though in his own kingdom he had been born poor. 15 I saw all the living who move about under the sun, along with that2 youth who was to stand in the king's3 place. 16 There was no end of all the people, all of whom he led. Yet those who come later will not rejoice in him. Surely this also is vanity and a striving after wind. 4 Fear God 5 Guard your steps when you go to the house of God. To draw near to listen is better than to offer the sacrifice of fools, for they do not know that they are doing evil. 2 5 Be not rash with your mouth, nor let your heart be hasty to utter a word before God, for God is in heaven and you are on earth. Therefore let your words be few. 3 For a dream comes with much business, and a fool's voice with many words. 4 When you vow a vow to God, do not delay paying it, for he has no pleasure in fools. Pay what you vow. 5 It is better that you should not vow than that you should vow and not pay. 6 Let not your mouth lead you6 into sin, and do not say before the messenger7 that it was a mistake. Why should God be angry at your voice and destroy the work of your hands? 7 For when dreams increase and words grow many, there is vanity;8 but9 God is the one you must fear. The Vanity of Wealth and Honor 8 If you see in a province the oppression of the poor and the violation of justice and righteousness, do not be amazed at the matter, for the high official is watched by a higher, and there are yet higher ones over them. 9 But this is gain for a land in every way: a king committed to cultivated fields.10 10 He who loves money will not be satisfied with money, nor he who loves wealth with his income; this also is vanity. 11 When goods increase, they increase who eat them, and what advantage has their owner but to see them with his eyes? 12 Sweet is the sleep of a laborer, whether he eats little or much, but the full stomach of the rich will not let him sleep. 13 There is a grievous evil that I have seen under the sun: riches were kept by their owner to his hurt, 14 and those riches were lost in a bad venture. And he is father of a son, but he has nothing in his hand. 15 As he came from his mother's womb he shall go again, naked as he came, and shall take nothing for his toil that he may carry away in his hand. 16 This also is a grievous evil: just as he came, so shall he go, and what gain is there to him who toils for the wind? 17 Moreover, all his days he eats in darkness in much vexation and sickness and anger. 18 Behold, what I have seen to be good and fitting is to eat and drink and find enjoyment11 in all the toil with which one toils under the sun the few days of his life that God has given him, for this is his lot. 19 Everyone also to whom God has given wealth and possessions and power to enjoy them, and to accept his lot and rejoice in his toil—this is the gift of God. 20 For he will not much remember the days of his life because God keeps him occupied with joy in his heart. 6 There is an evil that I have seen under the sun, and it lies heavy on mankind: 2 a man to whom God gives wealth, possessions, and honor, so that he lacks nothing of all that he desires, yet God does not give him power to enjoy them, but a stranger enjoys them. This is vanity;12 it is a grievous evil. 3 If a man fathers a hundred children and lives many years, so that the days of his years are many, but his soul is not satisfied with life's good things, and he also has no burial, I say that a stillborn child is better off than he. 4 For it comes in vanity and goes in darkness, and in darkness its name is covered. 5 Moreover, it has not seen the sun or known anything, yet it finds rest rather than he. 6 Even though he should live a thousand years twice over, yet enjoy13 no good—do not all go to the one place? 7 All the toil of man is for his mouth, yet his appetite is not satisfied.14 8 For what advantage has the wise man over the fool? And what does the poor man have who knows how to conduct himself before the living? 9 Better is the sight of the eyes than the wandering of the appetite: this also is vanity and a striving after wind. 10 Whatever has come to be has already been named, and it is known what man is, and that he is not able to dispute with one stronger than he. 11 The more words, the more vanity, and what is the advantage to man? 12 For who knows what is good for man while he lives the few days of his vain15 life, which he passes like a shadow? For who can tell man what will be after him under the sun? Footnotes [1] 4:4 The Hebrew term hebel can refer to a “vapor” or “mere breath”; also verses 7, 8, 16 (see note on 1:2) [2] 4:15 Hebrew the second [3] 4:15 Hebrew his [4] 4:16 Ch 4:17 in Hebrew [5] 5:2 Ch 5:1 in Hebrew [6] 5:6 Hebrew your flesh [7] 5:6 Or angel [8] 5:7 The Hebrew term hebel can refer to a “vapor” or “mere breath”; also verse 10 (see note on 1:2) [9] 5:7 Or For when dreams and vanities increase, words also grow many; but [10] 5:9 The meaning of the Hebrew verse is uncertain [11] 5:18 Or and see good [12] 6:2 The Hebrew term hebel can refer to a “vapor” or “mere breath”; also verses 4, 9, 11 (see note on 1:2) [13] 6:6 Or see [14] 6:7 Hebrew filled [15] 6:12 The Hebrew term hebel can refer to a “vapor” or “mere breath” (see note on 1:2) (ESV) Psalm: Psalm 77 Psalm 77 (Listen) In the Day of Trouble I Seek the Lord To the choirmaster: according to Jeduthun. A Psalm of Asaph. 77   I cry aloud to God,    aloud to God, and he will hear me.2   In the day of my trouble I seek the Lord;    in the night my hand is stretched out without wearying;    my soul refuses to be comforted.3   When I remember God, I moan;    when I meditate, my spirit faints. Selah 4   You hold my eyelids open;    I am so troubled that I cannot speak.5   I consider the days of old,    the years long ago.6   I said,1 “Let me remember my song in the night;    let me meditate in my heart.”    Then my spirit made a diligent search:7   “Will the Lord spurn forever,    and never again be favorable?8   Has his steadfast love forever ceased?    Are his promises at an end for all time?9   Has God forgotten to be gracious?    Has he in anger shut up his compassion?” Selah 10   Then I said, “I will appeal to this,    to the years of the right hand of the Most High.”2 11   I will remember the deeds of the LORD;    yes, I will remember your wonders of old.12   I will ponder all your work,    and meditate on your mighty deeds.13   Your way, O God, is holy.    What god is great like our God?14   You are the God who works wonders;    you have made known your might among the peoples.15   You with your arm redeemed your people,    the children of Jacob and Joseph. Selah 16   When the waters saw you, O God,    when the waters saw you, they were afraid;    indeed, the deep trembled.17   The clouds poured out water;    the skies gave forth thunder;    your arrows flashed on every side.18   The crash of your thunder was in the whirlwind;    your lightnings lighted up the world;    the earth trembled and shook.19   Your way was through the sea,    your path through the great waters;    yet your footprints were unseen.320   You led your people like a flock    by the hand of Moses and Aaron. Footnotes [1] 77:6 Hebrew lacks I said [2] 77:10 Or This is my grief: that the right hand of the Most High has changed [3] 77:19 Hebrew unknown (ESV) New Testament: John 19 John 19 (Listen) Jesus Delivered to Be Crucified 19 Then Pilate took Jesus and flogged him. 2 And the soldiers twisted together a crown of thorns and put it on his head and arrayed him in a purple robe. 3 They came up to him, saying, “Hail, King of the Jews!” and struck him with their hands. 4 Pilate went out again and said to them, “See, I am bringing him out to you that you may know that I find no guilt in him.” 5 So Jesus came out, wearing the crown of thorns and the purple robe. Pilate said to them, “Behold the man!” 6 When the chief priests and the officers saw him, they cried out, “Crucify him, crucify him!” Pilate said to them, “Take him yourselves and crucify him, for I find no guilt in him.” 7 The Jews1 answered him, “We have a law, and according to that law he ought to die because he has made himself the Son of God.” 8 When Pilate heard this statement, he was even more afraid. 9 He entered his headquarters again and said to Jesus, “Where are you from?” But Jesus gave him no answer. 10 So Pilate said to him, “You will not speak to me? Do you not know that I have authority to release you and authority to crucify you?” 11 Jesus answered him, “You would have no authority over me at all unless it had been given you from above. Therefore he who delivered me over to you has the greater sin.” 12 From then on Pilate sought to release him, but the Jews cried out, “If you release this man, you are not Caesar's friend. Everyone who makes himself a king opposes Caesar.” 13 So when Pilate heard these words, he brought Jesus out and sat down on the judgment seat at a place called The Stone Pavement, and in Aramaic2 Gabbatha. 14 Now it was the day of Preparation of the Passover. It was about the sixth hour.3 He said to the Jews, “Behold your King!” 15 They cried out, “Away with him, away with him, crucify him!” Pilate said to them, “Shall I crucify your King?” The chief priests answered, “We have no king but Caesar.” 16 So he delivered him over to them to be crucified. The Crucifixion So they took Jesus, 17 and he went out, bearing his own cross, to the place called The Place of a Skull, which in Aramaic is called Golgotha. 18 There they crucified him, and with him two others, one on either side, and Jesus between them. 19 Pilate also wrote an inscription and put it on the cross. It read, “Jesus of Nazareth, the King of the Jews.” 20 Many of the Jews read this inscription, for the place where Jesus was crucified was near the city, and it was written in Aramaic, in Latin, and in Greek. 21 So the chief priests of the Jews said to Pilate, “Do not write, ‘The King of the Jews,' but rather, ‘This man said, I am King of the Jews.'” 22 Pilate answered, “What I have written I have written.” 23 When the soldiers had crucified Jesus, they took his garments and divided them into four parts, one part for each soldier; also his tunic.4 But the tunic was seamless, woven in one piece from top to bottom, 24 so they said to one another, “Let us not tear it, but cast lots for it to see whose it shall be.” This was to fulfill the Scripture which says,   “They divided my garments among them,    and for my clothing they cast lots.” So the soldiers did these things, 25 but standing by the cross of Jesus were his mother and his mother's sister, Mary the wife of Clopas, and Mary Magdalene. 26 When Jesus saw his mother and the disciple whom he loved standing nearby, he said to his mother, “Woman, behold, your son!” 27 Then he said to the disciple, “Behold, your mother!” And from that hour the disciple took her to his own home. The Death of Jesus 28 After this, Jesus, knowing that all was now finished, said (to fulfill the Scripture), “I thirst.” 29 A jar full of sour wine stood there, so they put a sponge full of the sour wine on a hyssop branch and held it to his mouth. 30 When Jesus had received the sour wine, he said, “It is finished,” and he bowed his head and gave up his spirit. Jesus' Side Is Pierced 31 Since it was the day of Preparation, and so that the bodies would not remain on the cross on the Sabbath (for that Sabbath was a high day), the Jews asked Pilate that their legs might be broken and that they might be taken away. 32 So the soldiers came and broke the legs of the first, and of the other who had been crucified with him. 33 But when they came to Jesus and saw that he was already dead, they did not break his legs. 34 But one of the soldiers pierced his side with a spear, and at once there came out blood and water. 35 He who saw it has borne witness—his testimony is true, and he knows that he is telling the truth—that you also may believe. 36 For these things took place that the Scripture might be fulfilled: “Not one of his bones will be broken.” 37 And again another Scripture says, “They will look on him whom they have pierced.” Jesus Is Buried 38 After these things Joseph of Arimathea, who was a disciple of Jesus, but secretly for fear of the Jews, asked Pilate that he might take away the body of Jesus, and Pilate gave him permission. So he came and took away his body. 39 Nicodemus also, who earlier had come to Jesus5 by night, came bringing a mixture of myrrh and aloes, about seventy-five pounds6 in weight. 40 So they took the body of Jesus and bound it in linen cloths with the spices, as is the burial custom of the Jews. 41 Now in the place where he was crucified there was a garden, and in the garden a new tomb in which no one had yet been laid. 42 So because of the Jewish day of Preparation, since the tomb was close at hand, they laid Jesus there. Footnotes [1] 19:7 Greek Ioudaioi probably refers here to Jewish religious leaders, and others under their influence, in that time; also verses 12, 14, 31, 38 [2] 19:13 Or Hebrew; also verses 17, 20 [3] 19:14 That is, about noon [4] 19:23 Greek chiton, a long garment worn under the cloak next to the skin [5] 19:39 Greek him [6] 19:39 Greek one hundred litras; a litra (or Roman pound) was equal to about 11 1/2 ounces or 327 grams (ESV)

Jean & Mike Do The New York Times Crossword
Tuesday, September 21, 2021 - Hail to LOONA Lewis

Jean & Mike Do The New York Times Crossword

Play Episode Listen Later Sep 22, 2021 13:53


A fun Tuesday crossword, with some legal puns (are there any other kind?) to spice things up. Jean tore through the crossword in under 12 minutes, while Mike, convinced that 10D, Brand of caramel candy, WERTHERS, should be spelled WORTHERS, spent an absurdly long amount of time before realizing that the cross, 16A, British pop singer Lewis, was in fact LEONA, and not her lesser known rival, LOONA Lewis. In other news, it's Triplet Tuesday, and Jean again shows her mastery of the 3 letter answer. For all the deets, download and listen up.These podcasts work particularly well when you can see the answers as you follow the conversation. If you don't have them handy, you can always find the completed grid + clues at xwordinfo.com.

Grow the Grind
It's a Go Dawgs...Hail State of Mind with Hannah Levi & Abbey Daniel

Grow the Grind

Play Episode Listen Later Sep 21, 2021 62:57


(Season 2: Episode 10) It's was a Hail State kind of day as Grow the Grind sat down with 2 top DAWGS! The Mississippi State Maroon pride shines throughout this incredible POD. As 2020 Academic All-American, US Open qualifier, and the stroke play Medalist at this years North and South Amateur... Abbey Daniel, and her Bulldog teammate... the winner of the Inaugural Sea Island Women's Amateur and a 2019 WGCA Academic All-American... Hannah Levi... sat down with hosts Alli and Jason Wiertel to talk Vision 54, battling injury to make big gains, practice round tips, Coach Ewing and the culture at Mississippi State, even a little hunting talk out of Hannah. Episode 10 of Season 2!!!!

Defeat the [DC Sports] Curse
NFL Picks for Week 2

Defeat the [DC Sports] Curse

Play Episode Listen Later Sep 19, 2021 37:10


Looking to make some $$$ on a Sunday when Washington Football Team has the day off? Look no further than FP and LP's Sunday prediction picks. LP and FP dive into each game making their predictions for the spread and O/Us. Looking to make $9,776.59? Pick all the money line picks and you can make that with just a $10 wager. Or Just pick a few and still make some money. All fun and games, especially when your team is not involved. Hail to the Football Team!    Photo Credit: mybookie.ag

The Ex-Man with Doc Coyle
Marc Rizzo (Hail The Horns, Revenge Beast, ex-Soulfly, ex-Ill Nino)

The Ex-Man with Doc Coyle

Play Episode Listen Later Sep 15, 2021 88:43


Doc welcomes guitarist, Marc Rizzo, to the show for the second time, and they talk about Marc's recent exit from Soulfly after 18 years, the online drama and back and forth between him and the Soulfly camp, the difficulty he experienced during the pandemic, the ethics of how bands should regard hired members, his open schedule allowing him to relaunch his career as a solo artist, starting his new band, Hail The Horns, with Tony Campos (Static-X), and how he has evolved with technology using mediums like Twitch to grow his fanbase. This episode features the songs "Rotation" by Marc Rizzo and "God of Thunder" by Hail the Horns. Follow Marc on Instagram @marcrizzo_ripandshred and Twitter @rizzomarc Follow Doc on Instagram and Twitter @DocCoyle Please support this episode's sponsor Godsize Records at https://www.godsizerecs.com/ Listen to more great podcasts like this at soundtalentmedia.com/ Learn more about your ad choices. Visit megaphone.fm/adchoices

Cognitive Dissonance
Episode 594: Hail Satanists!

Cognitive Dissonance

Play Episode Listen Later Sep 13, 2021 86:45


Show Notes