Podcasts about Badge

Share on
Share on Facebook
Share on Twitter
Share on Reddit
Copy link to clipboard
  • 1,009PODCASTS
  • 2,240EPISODES
  • 42mAVG DURATION
  • 1DAILY NEW EPISODE
  • Oct 16, 2021LATEST
Badge

POPULARITY

20112012201320142015201620172018201920202021


Best podcasts about Badge

Show all podcasts related to badge

Latest podcast episodes about Badge

Classic Movie Reviews
Episode 206 - Touch Of Evil

Classic Movie Reviews

Play Episode Listen Later Oct 16, 2021 56:16


"Touch of Evil" 1958 and 1998 Director's cut is based on the 1956 novel Badge of Evil. Orson Welles directed the movie, rewrote parts of the script, and played Hank Quinlan the corrupt and double-crossing Police Captain from Los Robles a U.S. border town. Car bomb deaths, drug smuggling, racial tensions, kidnapping, and the ultimate betrayal of a longtime friendship are woven into this mesmerizing tale as only Welles could tell it.Charlton Heston is Ramon Vargas high-ranking member of Mexican law enforcement, Janet Leigh as Susan Vargas the newly wed bride, and Joseph Calleia, in a career-defining role, as Police Officer Pete Menzies. There are excellent performances from many including Akim Tamiroff as Joe Grandi, Marlene Dietrich as Tanya, and Dennis Weaver as the Night Manager. Enjoy!

YCSO: Behind the Badge
YCSO Behind the Badge - The 2007 5-month long Phillip Watts Robbery & Shooting Spree

YCSO: Behind the Badge

Play Episode Listen Later Oct 15, 2021 39:23


From October 2007 to February 2008 a string of harrowing armed robberies and shootings took place in York County. 14 years ago this month a crime spree began in York County that would put most everyone on edge. Phillip Watts would rob stores all the while shoot two clerks and two customers after they complied with his demands. Watts was finally arrested at a Rock Hill apartment off Riverview Road on Feb. 18 after a DNA match identified him. To go into detail of this case more in depth Sheriff Kevin Tolson and Solicitor Kevin Brackett to join us this week on the podcast to talk about the crimes and what it was like to prosecute this case.

EXP. Share: Pokemon Playthrough Podcast
The Dreamyard, Route 3, Wellspring Cave, Nacrene City, & Basic Badge (#087)

EXP. Share: Pokemon Playthrough Podcast

Play Episode Listen Later Oct 12, 2021 67:49


With the Cut HM in hand, Joshua & Mr. Keepsies take down the Team Plasma grunts who were beating up a Munna for its sweet, sweet dream juice. So much for "liberating" Pokémon. From there, they head north and encounter a bunch of little pukes who challenge them to battle, shortly before they once again get accosted by Plasma grunts who've made off with one of Bianca's Pokémon. In hot pursuit, they venture into Wellspring Cave and are bombarded by an astoundingly lazy and ugly new 'mon, many of which must be dispatched before they can head west to Nacrene City to face off against Gym Leader Lenora. Notes: Keep your Nosepasses clean and tidy with Manscaped, our first official sponsor! Get 20% off your order and free shipping with promo code EXPSHARE at Manscaped.com!

Good Money Good Hands Good Work
Greg McKeown—Why Burnout Is Not a Badge of Honor

Good Money Good Hands Good Work

Play Episode Listen Later Oct 11, 2021 57:28


Enter the $500 Good Money Giveaway now: https://forms.gle/GiQRLc38nMshydzq8     What if the hardest, most challenging things you do could be easy? Even fun? My guest Greg McKeown says there is a way and he's here to share his proven secrets with you. Easy isn't lazy—it's actually smart. Greg shares how you can get effortless results without using all your energy and burning out. It's time to stop working twice as hard to achieve half as much. For all you fellow overachievers out there, this is the episode for you.      3 KEYS TO SUCCESS:   Be careful about what you say yes to if you want to reach a high level of success Burnout is not a badge of honor Preserve your energy for the things that matter most     Follow Derrick on Instagram for daily money tips! https://www.instagram.com/derricktkinney/

Les Grosses Têtes
PÉPITE - Estéban n'a toujours pas son badge pour rentrer à RTL

Les Grosses Têtes

Play Episode Listen Later Oct 8, 2021 3:56


A son arrivée dans les locaux de RTL, Estéban à eu quelques soucis pour rentrer... Découvrez la page Facebook Officielle des "Grosses Têtes" : https://www.facebook.com/lesgrossestetesrtl/ Retrouvez vos "Grosses Têtes" sur Instagram : https://bit.ly/2hSBiAo Découvrez le compte Twitter Officiel des "Grosses Têtes" : https://bit.ly/2PXSkkz Toutes les vidéos des "Grosses Têtes" sont sur YouTube : https://bit.ly/2DdUyGg

YCSO: Behind the Badge
YCSO Behind the Badge - Mounted Patrol

YCSO: Behind the Badge

Play Episode Listen Later Oct 8, 2021 43:02


Horses were the first patrol car for all law enforcement officers until the invention of the automobile. Today horses are still an effective tool for policing and community relations.

upside
[Think Like An Owner] Badge Stone – Earning His Badge and Making His Mark in Search Fund Investments – Ep. 83

upside

Play Episode Listen Later Oct 6, 2021 64:58


This week's feed drop features Alex Bridgeman and his podcast, Think Like An Owner.Alex's guest is Badge Stone. Badge started his search journey with Stone Pump & Trench that was on the verge of bankruptcy when he acquired it. After turning it around, he acquired another company called Perimeter Security. He sold both and made investing in searchers his full-time role through his firm, WSC & Company, alongside two other partners. Badge has invested in over a hundred searchers and has extensive experience as both an investor and operator.WSC's seven-person team is based in Charlotte, North Carolina and is investing and of its second fund, a $100 million fund closed earlier this year focused on the traditional search fund model.During our discussion, we talk about turning Stone Pump & Trench around, lessons learned from over a hundred search fund investments, a few notable companies, he's been a part of, what's typically missing in a new company, and a wide range of discussion on board construction and usage for entrepreneurs and investors alike. This episode is fantastic and I learned a ton and I think you will too.You can subscribe to Think Like An Owner on iTunes, Spotify, Google Podcasts, Stitcher, Breaker, and TuneIn.Follow Alex Bridgeman on TwitterFollow upside on TwitterJoin the upside network

Live Your Authentic Life
There is no Badge for Burnout

Live Your Authentic Life

Play Episode Listen Later Oct 5, 2021 17:57


Are you sick and tired of being sick and tired? Yes, child, yes! Then keep listening to lay that ish down once and for all and get your joy back.

Crime and Conjure
Protected By The Badge: The Murder of Sherri Rasmussen

Crime and Conjure

Play Episode Listen Later Oct 5, 2021 41:09


The blue wall of silence is an informal code among police officers not to report on a fellow cop's misconduct or crimes. Any officers who refuse to lie to protect a corrupt cop may be threatened and ostracized by their fellow police officers. This glorified corruption goes back as far as we can tell to at least the 1800's. In Los Angeles California, that blue code allowed a murderer to escape justice for 23 years. --- This episode is sponsored by · Anchor: The easiest way to make a podcast. https://anchor.fm/app

Roaring Elephant
Episode 265 – Securing the Open Source Ecosystem (2)

Roaring Elephant

Play Episode Listen Later Oct 5, 2021 33:30


Join David A. Wheeler, Director of Open Source Supply Chain Security at the Linux Foundation and us for a discussion about securing the Open Source Ecosystem. The Linux Foundation has had a couple of initiatives around this and they now all culminate in the recently minted Open SSF. Find out more about the Open SSF foundation and other things David talked about using the following links: OpenSSF Security Metrics Project: https://metrics.openssf.org/search?q=kubernetesBest practices Badge: https://bestpractices.coreinfrastructure.org/Best practices Badge "passing" criteria: https://bestpractices.coreinfrastructure.org/criteria/0Best Practices Badge Statistics: https://bestpractices.coreinfrastructure.org/project_statsOpenSSF edX Courses: https://openssf.org/edx-courses/OpenSSF Security Scorecards: https://github.com/ossf/scorecard Please use the Contact Form on this blog or our twitter feed to send us your questions, or to suggest future episode topics you would like us to cover.

YCSO: Behind the Badge
YCSO Behind the Badge - YCSO Information Technology

YCSO: Behind the Badge

Play Episode Listen Later Oct 1, 2021 40:23


There are three IT gurus at the YCSO that specialize in maintaining all computers, software, in and out of patrol cars, and basically anything electronic at the YCSO. On this Behind the Badge we talk about the huge job is it to juggle it all.

Metal Nerdery
110: Metal Soundtracks

Metal Nerdery

Play Episode Listen Later Sep 30, 2021 86:35


There was a time when Movie SOUNDTRACKS basically sucked and the only thing that could make them even remotely palatable was the inclusion of a Metal band, really any metal band!  (Obviously NOT Europe!).  Thankfully, we now live in the modern age, where it's not uncommon to see bands like Slayer and Pantera included on a moving picture soundtrack. (And as you'll soon discover, bolth bands have actually been on several soundtracks, and actually on one together!!!) Time to corral your free-range “pre-steak”, find out the answer regarding “Greg's” whereabouts, butter up the relaxer-infused jerky-flavored popcorn and get ready to JOIN US for some fuun, as we indulge in the “sultry sounds of nice” and stroll through the realm of METAL SOUNDTRACKS.    Visit www.metalnerdery.com/podcast for more on this episode   Leave us a Voicemail to be played on a future episode: 980-666-8182 Metal Nerdery Tees and Hoodies – metalnerdery.com/merch and kindly leave us a review and/or rating on the iTunes/Apple Podcasts - Spotify or your favorite Podcast app Listen on iTunes, Spotify, Podbean, Google Podcasts or wherever you get your Podcasts. Follow us on the Socials: Facebook - Instagram - Twitter   Email: metalnerdery@gmail.com   Can't be LOUD Enough Playlist on Spotify   Show Notes: (00:01) - #thesultrysoundsofniceASMR #Fuun #holdup #ohfuck / ***WELCOME BACK to the #MetalNerderyMetalverse !!!*** Intros and #pleasantries and #nonesuch #thisepisodes #beeroftheepisode #thisepisodesbeeroftheepisode #thisone #intuitive and #clear #again #PontoonBrewing #AlexOoohOfApproval #thisparticularepisodesbeerofthisepisode #PontoonBrewing (said that earlier…) #slam #CrushingWaves #WhhheatBeer #WhhhhaitWhhhhat? and also a #WheatBeer  #grassyass #mids #beatsbydre #freeplug #yourwelcome ***#albumcover #description in a #nutshell #rhymes with #MetalNerderyHQ33rdFloorInvertedUndergroundBunkerPoonStudios #tartsalivationASMR #notchunky / a #messenge but first a #klinky or a #halfklinky or a #klinkyandahalf (#MetalNerderyMessenge, Pt. 1)   (04:00) – Soundtracks, movies, and Metal (especially when soundtracks had METAL! #MetalNerderyBurpCoreASMR) / #fasttimesatridgemonthigh #MikeDamone #sidetwoofledzeppelinfour #wrongsong and a #tangentional #familyguymoment #breakfastcandles /#mainstreamocity of Metal on a soundtrack used to be #rare…and #treasured / Early #soundtrack #memories (#MaximumOverdrive #ACDC and #WhoMadeWho #originalsoundtrackalbum #overtangentionalled) #theydidscore / Some other #significant #Metal #contributions to #soundtracks including #Slayer #covertunehatred #burpfadeoutASMR #FFS #turnitoffnow / ***Whenever #metal was on a #soundtrack it was cause for #celebration and #rejoicing and also a #verybigdill #waitwhat #ididnteventhinkaboutthehelmet although #ilovethehelmet #contradiction #recordscratch*** A brief trip down the rabbit hole of #metalsoundtracks #metalsoundtrackASMR and #fuun in #Angerland #bigdill #bolth #backintheday   (11:42) - #thetitleytrack #Biohazard and #Onyx JUDGMENT NIGHT #judgmentnight (the #originalmotionpicturesoundtrack for the film Judgment Night) / #justamoment ANOTHER BODY MURDERED #MikePatton and #BooYaaTRIBE #publicenemyesque #minisoundtrackalbumdive / #yougottaplayTheHelmet #Helmet #ilovethehelmet #drillsolo #ting #loveit JUST ANOTHER VICTIM #pitchshiftedtimetravellingtriggery / #Pinche #Slayer and #IceT DISORDER #fuckingSlayer #FuckingSlayerASMR #wedontneedyourwar #thankyouandfuckoff #fuun   (16:34) – Heavy Metal-The Movie (#circa1981) #gambling #preMetal #SammyHagar #titleetrack #uhhyeah #VeryPriest #precomemetal #donaldfagen (***#SteelyDan was the #correctanswer***) / #BlackSabbath THE MOB RULES (“If you listen to fools…”) #BlackSabbathTrumpsEverything  #TonyIommiForPresident (or even also #MattPikeForPresident) #makingupforitintheshownotesASMR #GodBless #MetalManifesto #episode110 / #burpbelchingmaniaASMR / #CannibalCorpse HAMMER SMASHED FACE (from Ace Ventura Pet Detective) #excuseme #isGregHere? #thankyou #AceVenturaPetDetective #nevergetsold #newfoodgenre #spiderconspiracyASMR #spiderpropaganda #uhhhYeahhh   (22:20) – The Crow #thesomething #PanterA ***NOT #the #vadge (#RespectTheBadgina #RespectTheVadge) but also #TheBadge or #TheBadgina*** #thereitis / ***And now, Ladies and Gentlemen, Mr. Tom Morello*** #eembahbahbah #justataste of #jazzyshred #guitarsolo with #flava #TomMorelloGuitarSolo #veryfuckingcool #Moes #TheVoicemailSegment ***GIVE US A CALL AND LEAVE US A VOICEMAIL AT 980-666-8182***/ DARKNESS #RageAgainstTheMachine #RATM #waitforit #fastfingers and #extremelytasteful***Is the #vadge out?  #Pantera covering THE BADGE by #PoisonIdea (still from The Crow #originalmotionpicturesoundtrackalbumrecordingsongcontribution #PanterAized #weight / #ahnold #impression #notreally #heavymetty #vettyheavymetty / #amomentoftirade #regarding #backintheday   (28:42) – A #Revelation from Russell that sounds like it's 40 years old, but it's actually not…and a moment of #tangentionalalityismness to the 90's (see also #DaveJerden #AIC and #Anthrax for related #tangentionalality) #everyonechangedinthe90s / A “cow” equals  #presteak #Gertrude #freeplug from #TheRibLounge from #RonAtTheRibLoungeOfficial #neverseentit #episodederailmentASMR and #math #itswhatido ***metalnerdery@gmail.com #9806668182ASMR #GeoffTaintASMR  / #theoriginalmotionpicturesoundtrackalbumsongtrackthing from #stillFreddyVsJason Freddy Vs Jason and a #verynecessary #tangentional #notthat #ultratangentional #blackalbumreference #twelveyearsafter #blowoutthelines / #sparktical #Sepultura with #MikePatton THE WASTE ***See also #MrBungle…basically, Mike Patton + Any Band = a new version of Mr. Bungle*** #readthoselyrics #heedthoselyrics / To Mike:  #hail and #bewell / #Isolation and a #tangentional reference back to #Sepultura (and #Quadra)    (35:25) – Demon Night (#originalmotionmoviepicturesoundtrackalbumrecordsongcontributionASMR) and #TheMatrix #ThePunisher and the #AlexOoohOfApproval #regarding #Slayer and #Hatebreed and various, lesser mentioned soundtracks and a personal tangentional moment of 90's #alternativemetal and some #tangentional #idonthatepussy #BushHate #overrated #youractingsuckstoobutnotasmuchasyourband  #passiveaggressiveASMR / #inwardburp #notfdaapprovedASMR #HeyManNiceShot / “The Spawn” #originalmovingmotionpicturemusicsoundtracktacticalsongobligation #WaitWho #Dreadful #SimplyDreadfulASMR (***It was #EVH not #MJ***) #Slayer and #AtariTeenageRiot NO REMORSE (I WANNA DIE) #hateitalready #fuckthat   (41:08) - Rivers Edge #RiversEdge #backhanded #itsnotashittymovie #itsgreatbutitsucks #HallowsEve LETHAL TENDENCIES (from the #ATL!!!) #beforetheywerestars #whatsthecrazyguy #mostofthemare #weirdfeeling #WREKage #flashback / #SlayerizeMe with some #Slayer #MCTentacleChoice EVIL HAS NO BOUNDARIES #ifeelbetternow #tingly #itsmarked   (46:33) – The #anonymous #Angerman and the opposite of #fuun is #evil / #ballz #adifferentkindofexcitermoment #andthereitis (***the #actual track was #TrickOrTreat which is a #killeropener***) / #overrelaxered #medicateddemons / Strangeland (the motion picture soundtrack album release thing) #Soulfly EYE FOR AN EYE #grunt #standby for #tentacledifficulties #seewhatIdidthere? / ***PLEASE PAY ATTENTION FOR THIS NEXT PART OF THE SHOW!!!*** #thishalfoftheepisodesthisbeeroftheepisode #thesecondhalfoftheepisodesbeerofthispartoftheepisode #theconclusionbeeroftheepisode #alsoPontoonBrewing WAKE ZONE #pellell see also a #paleale #thatthingisstickingup #WakeZone #markthetime #manbeer #PontoonBrewing #yourewelcome #russellburpASMR #totallyRussell #burnedmyeyesalittle EYE FOR AN EYE #primal #tribal #pribal #trimal #boLth #technicolorformusic see also #chromesthesia   (54:03) – Dracula 2000 (#uhhyeah) #SystemOfADown covering METRO by #Berlin and a #debatablemoment as to whether or not #SOAD would classify as #SkaThrash in terms of #genre and #wishingyoueverysuccess / AVOID THE LIGHT by #PanterA #greatesttits #yesplease #creepysoftintro (not the song but the band…) #Inslomo #lastsecond #wordplay #hahaha #irony #derpyderp See also #ReinventingTheMetal #cantbeloudenough #CBLE #goodone #onmicburpclubdubburpbassASMR   (1:01:50) – The movie from 1985 “Demons” (#notNightRanger #backingup) ***Pretty Maids #PrettyMaids – I mean it ain't no #RickSpringfield but it's close!***  (#pleasantlysurprised) and an #offtopic moment regarding #BillyIdol and that change from hard rock to more of a #metal sound #devilish It's #NOT #NightRanger its NIGHT DANGER #biggamble #areyouscared #talkyburp and #Doro #nicetoseeya #toseeyanice #burn from the #boozemaiden #saywhen #imgoodbabe #thisbetterbegood #itsallonme #redemption #definitelymetal #tentativetentacles NIGHT DANGER by #PrettyMaids and footage from #EvilDead #gropedbygreenery in the #musicvideo (***see also Tree “R-Word” Scene***#iykyk #NotTheTreeRWord #NotTreeR_d  #foliagefondling #treelove #theXword #tentacleovertime   (1:08:30) – From the soundtrack of #MaximumOverdrive and #ACDC DT #instrumental / ***picking back up from the earlier #messenge…#pleasehold… (#MetalNerderyMessenge, Pt. 2) #reallylong #TheMarkOfCain from #Australia is in a potentially similar vein as #TheHelmet.  The song is called:  TELL ME #notlive #sleepyballs #necessary #longintro #quitegood / A various other assortment of other bands and/or soundtracks and also/or #loans and #raingers or #lone #rangers #lonerangers #lonesrangers #bolth #noigetit #noteven #whocaresaboutEnglish #loopholegenre #noderp   (1:14:50) - #TenaciousD “The Pick of Destiny” ^ #ithinkitis #imdefinitelyprettysure KICKAPOO and #futuresteak #yeah***go watch the video…AND go watch the movie! *** #seekthestrawberryriver #jaybels #doublethemetal    (1;19:38) - The Punisher #Slayer #because #FuckingSlayer and #uhhyeahhh THE FINAL SIX ***send someone some #tentaclelove #today*** #notthefinalcountdown #ultraderpASMR #STFU THE FINAL SIX (because maybe you forgot about that part if your #adderall and/or #relaxers isn't and/or aren't working) #SlayerIsABlessing #feelingbetteralready from #boLth #ThePunisherSoundtrack and the #ChristIllusion album. #blessin #ilikeitalot / Perhaps a single volume for a multi-installment series…***THANK YOU FOR LISTENING TO AND SUPPORTING THE METAL NERDERY PODCAST!!!*** / #untilthenext #softoutro #andthereitis #GeezahTheButlah #buyourshit at metalnerdery.com/merch  #outofcontrol #waitWTF #holywhatthefucktitudeBatman #itsallbullshit #theresnomoon #educationalpurposes #thebadgina ^ - We at Metal Nerdery 33rd Floor Inverted Underground Bunker Poon (I.U.B.P.) Studios in the beautiful, lovely, and talented (and shaved) area of downtown Atlanta, Georgia, feel that we would be terribly remiss in our capacity as a Metal-centric podcast if we were to fail to include Tenacious D in the greater metropolitan pantheon of Metal Podcastery.     Also…We're assuming (really kind of praying…) that you can actually read and that you actually take the time to look at this ridiculousness.  We sincerely hope you can read.  If you can, in fact, read, we also hope that you'll help someone else to learn “how to read” and talk good.  If you've read this far, know that we heart you and THANK YOU SO MUCH for your listenership and continued support!!!  #HAIL to #RonnieJamesDio, to #MeatLoaf and to #YOU!!!  

Masks Off
Badge of Busy-ness with Jenn Taylor

Masks Off

Play Episode Listen Later Sep 30, 2021 46:07


This marks the 100th episode of Masks Off! We have utterly enjoyed recording this podcast and hope that you have enjoyed listening. We appreciate all of your support. In this episode we had an amazing conversation with Jenn Taylor. She offered so much wisdom on how we need to listen to our bodies and our intuition to live a more authentic and fulfilled life. When we don't tune in to our bodies and the messages that it gives us, we end up feeling anxious and unfilled and may have chronic pain. Pay attention to how Jenn coached Kim in real time to help her become aware of how she was a slave to her mind rather than being free by listening to her body. “When receiving intuitive information through your body, the more you listen, the more you hear.” ~Karen Whitaker Three Key Takeaways: 1. What are some issues that can result if we don't tune in to our bodies? ~ @ 7 minutes 2. Jen mentioned a book that can really explains this issue: ~ 12 minutes 3. What does it look like to just “BE”? ~ 33 minutes To access Jenn's “Do Less BE More” workshop link: https://vimeo.com/574572366 More information about Jenn: Jenn is a mom of 4, homeschooling her youngest. She lives in Palm Coast, FL, and absolutely loves being outdoors in nature and at the beach. She owns a holistic coaching business. She works with entrepreneurs, overwhelmed Mommas, coaches, healers, creatives who want to take their businesses and personal lives to the next level and create the life they're truly designed for. Jenn uses her 15 plus years experience in the holistic community as a Certified BodyMind Coach, Reiki Master, Intuitive, Meditation Coach to serve and support my clients' journeys. She teaches clients to reconnect with their body, its messages, and inner wisdom. She helps clients reveal blockages, and old beliefs and patterns that are keeping them stuck. Her clients start to realize they are messy humans AND divine creations, and they begin to honor both. Her clients know they're made for more! They want to make a serious impact on their communities and the world. As a result her clients are empowered to make aligned decisions in their lives and businesses. They stop over-giving. They say no to everything that drains them. They call in abundance. They experience less anxiety, stress, pain and frustration. Their confidence skyrockets and they learn to trust themselves! They experience true embodiment, and that's the key to moving forward and making change. Connect With Jenn: Website: www.JenniferTaylor.blog Facebook: www.facebook.com/jennifertaylor.blog IG: www.instagram.com/jennifer_lin_taylor Email: jennifer@jennifertaylor.bloglon Go to our Teachable Online School and check out our courses including our signature FREE Balancing Your Backpack Course https://masksoff.teachable.com/courses To Contact Us: Instagram: @masksoffcommunity FB Masks Off Community: https://www.facebook.com/groups/masksoffcommunity Masks Off Email: podcastmasksoff@gmail.com Masks Off YouTube Channel: https://youtube.com/channel/UCaWJfO7ZFd4aYBX3e-clj9Q Tia Fagan Website: tiafagan.com Facebook: @tiafagancoach Instagram: @tiafagancoach Email: tiafagancoach@gmail.com Kim Gross Website: unlock-yourmind.com Facebook: @unlockyourmindhypnotherapy Email: kimgross@unlock-yourmind.com Episode 100

The Dori Monson Show
Hour 1: Former Sheriff's Deputy Jessy Bailey who turned in his badge yesterday

The Dori Monson Show

Play Episode Listen Later Sep 29, 2021 34:39


12PM - The Big Lead // GUEST: Former Sheriff's Deputy Jessy Bailey who turned in his badge yesterday because of the toxic leadership, slammed Mitzi with a now viral TikTok on the way out // Seattle City Attorney candidates vile tweets See omnystudio.com/listener for privacy information.

Roaring Elephant
Episode 264 – Securing the Open Source Ecosystem

Roaring Elephant

Play Episode Listen Later Sep 28, 2021 23:10


Join David A. Wheeler, Director of Open Source Supply Chain Security at the Linux Foundation and us for a discussion about securing the Open Source Ecosystem. The Linux Foundation has had a couple of initiatives around this and they now all culminate in the recently minted Open SSF. Find out more about the Open SSF foundation and other things David talked about using the following links: OpenSSF Security Metrics Project: https://metrics.openssf.org/search?q=kubernetesBest practices Badge: https://bestpractices.coreinfrastructure.org/Best practices Badge "passing" criteria: https://bestpractices.coreinfrastructure.org/criteria/0Best Practices Badge Statistics: https://bestpractices.coreinfrastructure.org/project_statsOpenSSF edX Courses: https://openssf.org/edx-courses/OpenSSF Security Scorecards: https://github.com/ossf/scorecard Please use the Contact Form on this blog or our twitter feed to send us your questions, or to suggest future episode topics you would like us to cover.

Vedic Worldview
Drugs and Spirit Medicine

Vedic Worldview

Play Episode Listen Later Sep 26, 2021 56:58


Humans have been using substances to have ‘extraordinary experiences' for millenia. Sometimes this is motivated by a simple sense of curiosity, and at other times it might be to ‘fill a void,' while in other cases it might be motivated by a promise of an elusive ‘spiritual experience.' In some cases it leads to addiction and dependence, while in others it might just be a bucket-list experience that someone moves on from.In this episode, Thom takes a non-judgemental look at the motivation and impact of such experiences, and outlines an alternative approach, one that's more sustainable and that leads to a ‘permanent high' that most people couldn't even conceive of.Episode Highlights: [00:40] The Desire to Belong[02:29] Tribal Life [04:27] A Sense of Identity [06:00] Join the Club [07:14] Human Beings Crave Variety [08:33] The Nature of the Knower [09:51] Badge of Rank [11:29] The Difference Between a Cult and a Religion [12:39] Shibboleth [13:25] Drugs [14:35] Why Drugs Work[15:59] Endogenous Chemicals [18:03] The Prime Directive of the Body[19:32] Ayahuasca, LSD, THC [21:13] Mimicking Molecules [22:44] Lizards on LSD and Psychotic Dogs [24:31] The Confused Body [26:23] Sublimation and Addiction [27:47] An Overload of Experience [29:35] Premature Cognitive Commitments [31:10] Psychedelic Experiences [33:11] Where Are the Icons of Drug Use? [35:19] A Sustainable Systematic Approach [37:32] What About Soma? [38:30] Vedic Meditation - A Better Methodology [39:44] An Overload of Experience [41:21] Supreme, Inner Contentedness [43:01] An Experience of Self [44:57] Our Body is a Drug-Producing Machine [46:19] Unsustainable Ways to Extraordinary Experiences [47:26] The 4/20 Club and Counterfeit Substances [49:13] Consciousness-Led Experiences [50:35] A Perpetual Psychedelic State [51:59] Learning the Sustainable Way [53:28] Being in the Tribe [54:29] A Regular Daily Practice Useful Linksinfo@thomknoles.com https://thomknoles.com/https://www.instagram.com/thethomknoles/https://www.facebook.com/thethomknoleshttps://www.youtube.com/c/thomknoles https://thomknoles.com/ask-thom-anything/

Bears Barroom Radio Network
The Barfly Tailgate Show | Browns Vs Bears

Bears Barroom Radio Network

Play Episode Listen Later Sep 26, 2021 66:24


The Barfly Tailgate Show returned to preview this weeks matchup with the Cleveland Browns.  Aldo Gandia and Dan Aquire joined the show live from Cleveland as they will be at the game today. Badge and Adlo started the show and kicked things off talking about Justin Fields making his first start for the Bears. Dan then joined the guys and the conversation turned to Matt Nagy and the fact that no one is really happy with the Matt Nagy era.  Great comments from the chat and questions kept the conversation moving. The guys closed the show with their score predictions.  

YCSO: Behind the Badge
YCSO Behind the Badge - A brief History of the York County Sheriff

YCSO: Behind the Badge

Play Episode Listen Later Sep 24, 2021 34:37


The York County Sheriff's Office has served the citizens of York County since 1786. On this Behind the Badge we briefly go over the 235 year history.

Get Behind Fanny
Get Behind Fanny: Episode 36

Get Behind Fanny

Play Episode Listen Later Sep 24, 2021 41:17


Episode 36! In this episode, we continue to shake things up by continuing our hashtag series. This episode is #JuneJams as we cover Fanny's guitarist June Millington! We asked June what three songs she wanted to feature and she picked “Place In The Country,” “Badge,” and “It Takes a Lotta Good Lovin'”. We'll continue with… Read more

YCSO: Behind the Badge
YCSO Behind the Badge - Mobile Field Force Team

YCSO: Behind the Badge

Play Episode Listen Later Sep 17, 2021 30:07


When civil unrest causes danger to life and property the YCSO Mobile Field Force Team is there to stand the line to protect protesters and property owners.

CantinaMX Futbol Podcast
Ep. 302: New Mexico badge leaks, Liga MX match week 8 results and Leagues Cup

CantinaMX Futbol Podcast

Play Episode Listen Later Sep 15, 2021 71:35


We recap the 3rd match of CONCACAF WCQ, talk about match week 8 results and Leagues Cup. How do you guys feel about the leaked badge? --- Send in a voice message: https://anchor.fm/cantina-mx/message

The Trashalanche Pokemon Podcast
The Kaya Lichtleitner Episode! Limitless, Belgian tournaments, Shadow Rider, Jolteon VMax, Jumpluff, Weezing, Spread Decks, Single Strike, Elemental Badge, and Draft The World Preview!

The Trashalanche Pokemon Podcast

Play Episode Listen Later Sep 15, 2021 79:35


We Wonder: Lent
The Only Badge Pauls Wears Galatians 2:17-21

We Wonder: Lent

Play Episode Listen Later Sep 14, 2021 14:25


Today we're continuing in Paul's letter to the Galatians: we're reading and wondering about Galatians 2:17-21. Want to follow along, or revisit something again? The passage, reflection, and wonder questions are all available, all season long, at wewonderpod.com/blog — you can also comment and share your own reflections on the passage! And don't forget to stay up to date by following us on Twitter and Instagram: just look for @wewonderpod. Thanks for listening, stay in touch, and I'll see you on Thursday!

YCSO: Behind the Badge
YCSO Behind the Badge - YCSO Dive Team

YCSO: Behind the Badge

Play Episode Listen Later Sep 10, 2021 30:05


The summer boating season is winding down, but that doesn't mean that the YCSO Lake Patrol and Dive team also stand down for the season.

Survival Is Insufficient Podcast
The Badge of Honor

Survival Is Insufficient Podcast

Play Episode Listen Later Sep 8, 2021 10:54


In this quick episode, I talk about the badge of honor many women who have gone through breast cancer feel they have earned. But sometimes that badge can block the work we need to do to be able to move forward more easily. For a more in-depth analysis of this concept,  be sure to check out episode 84 - I Am Not a Breast Cancer Survivor.

WGN - The After Hours with Rick Kogan Podcast
Former police officer and now author John Good discusses his new book ‘Blood on the Badge'

WGN - The After Hours with Rick Kogan Podcast

Play Episode Listen Later Sep 6, 2021


WGN Radio’s Rick Kogan is joined in studio by former police officer and now author John Good who talks about his first book “Blood on the Badge” which you can buy here. John also talks about his time as a cop in the Chicagoland area and how he ended up becoming an author. Follow Rick […]

Mosaic CLT
Blessing as a Badge - Pastor Naeem Fazal

Mosaic CLT

Play Episode Listen Later Sep 5, 2021 45:35


This message was recorded live from the Mosaic Church "Hope Center" in Charlotte North Carolina. If you enjoyed this message, please help us by sharing our content on social media and subscribing to our channel. You can also support this ministry financially by giving to Mosaic Church here - http://bit.ly/1PMsdn3 HOPE FOR ALL

West Michigan Live with Justin Barclay
Never Forget Means Never Forget - FULL SHOW 9-3-21

West Michigan Live with Justin Barclay

Play Episode Listen Later Sep 3, 2021 38:57


Johnny Brann joins in to talk about Voice for the Badge and remembering the heroes who died on 9/11.Also, Tom Antor joins in to talk about the Freedom Cruise.

YCSO: Behind the Badge
YCSO Behind the Badge - Serve & Connect, Greg's Groceries

YCSO: Behind the Badge

Play Episode Listen Later Sep 3, 2021 26:24


Founded in 2015, Serve & Connect is a South Carolina nonprofit working directly with law enforcement, community stakeholders, and citizen leaders, we aspire to improve neighborhoods challenged by poverty, crime, and neglect by building trust, optimizing collaboration, and fostering a shared sense of pride. The YCSO partners with S&C with the Greg's Groceries program.

Asking Why
Episode 39 | Sergeant Major Jeremy Morton (Retired) | Delta Force/Afghanistan | Part 2

Asking Why

Play Episode Listen Later Sep 1, 2021 123:00


CHECK THIS OUT!!!!    AFGHANISTAN. WAR. DESPAIR. HOPE. RESCUE. JESUS.    The Asking Why podcast with Clint Davis is bringing a very special episode covering the current crisis on Afghanistan and a unique testimony of epic proportions!!    Clint is an Army Veteran of Afghanistan and now a clinical therapist trained in trauma is HONORED to have his friend/brother in Christ, and fellow veteran Sergeant Major (retired) Jeremy Morton on the podcast!! Jeremy deployed numerous times to Iraq & Afghanistan to conduct direct action missions and hostage rescue operations as a part of Special Operations Unit, Delta Force. Clint and Jeremy want to take the moment to instill hope and give encouragement to our brothers and sisters in arms and everyone watching these events. You matter and your efforts matter!!    This podcast will be a two part event.   Part 1 will be covering Jeremy's time building up to 9/11 and Delta Force.    Part 2 will be his deployments and times of service along with some brief opinions on the current crisis. Clint and Jeremy hope this testimony shines light in these dark times and shows how Jesus can bring beauty from the ashes of war.    "Sergeant Major retired Jeremy Morton was born and raised in east Texas. In 1994 he graduated from Henderson High School and enlisted in the US Army. In December of 1994 Jeremy departed from Shreveport, Louisiana and traveled to Ft. Benning, GA for Infantry Basic Training. After graduating basic training, Jeremy attended Airborne School and the Ranger Indoctrination Program (RIP). Upon successful completion of RIP, Jeremy was assigned to the 75th Ranger Regiment, 1st Ranger Battalion in Savannah, GA where he served for 5 years as a mortar man, infantry team leader, infantry squad leader and infantry weapons squad leader. In the summer of 2000 Jeremy moved to Ft. Polk, LA to serve in the Joint Readiness Training Center as an Observer Controller.    After the terrorist attack on the World Trade Center on September 11, 2001, Jeremy answered the call to serve his country in a new capacity. In March of 2002 he volunteered for and attended the 1st Special Forces Operational Detachment - Delta (1st SFOD-D) assessment and selection. Jeremy successfully completed the selection process and moved to Ft. Bragg, NC with his wife Alyssa to begin Delta's Operator Training Course (OTC). Upon completion of OTC, Jeremy was officially assigned to the Unit and placed on an operational team. For the next 14 years, Jeremy deployed numerous times to Iraq & Afghanistan to conduct direct action missions and hostage rescue operations.    Sergeant Major Morton retired from active duty in June of 2016 and he and his family moved back to Shreveport, LA. Sergeant Major Morton's notable awards include the Afghanistan Campaign Medal with Campaign Star, The Iraq Campaign Medal with 6 Campaign Stars, Legion of Merit, Purple Heart, Bronze Star with Valor, 6 Bronze Stars, the Combat Infantryman's Badge, the United States Army Presidential Unit Citation, and the Valorous Unit Award."

Asking Why
Episode 39 | Sergeant Major Jeremy Morton (Retired) | Delta Force/Afghanistan | Part 1

Asking Why

Play Episode Listen Later Sep 1, 2021 122:17


CHECK THIS OUT!!!!    AFGHANISTAN. WAR. DESPAIR. HOPE. RESCUE. JESUS.    The Asking Why podcast with Clint Davis is bringing a very special episode covering the current crisis on Afghanistan and a unique testimony of epic proportions!!    Clint is an Army Veteran of Afghanistan and now a clinical therapist trained in trauma is HONORED to have his friend/brother in Christ, and fellow veteran Sergeant Major (retired) Jeremy Morton on the podcast!! Jeremy deployed numerous times to Iraq & Afghanistan to conduct direct action missions and hostage rescue operations as a part of Special Operations Unit, Delta Force. Clint and Jeremy want to take the moment to instill hope and give encouragement to our brothers and sisters in arms and everyone watching these events. You matter and your efforts matter!!    This podcast will be a two part event.   Part 1 will be covering Jeremy's time building up to 9/11 and Delta Force.    Part 2 will be his deployments and times of service along with some brief opinions on the current crisis. Clint and Jeremy hope this testimony shines light in these dark times and shows how Jesus can bring beauty from the ashes of war.    "Sergeant Major retired Jeremy Morton was born and raised in east Texas. In 1994 he graduated from Henderson High School and enlisted in the US Army. In December of 1994 Jeremy departed from Shreveport, Louisiana and traveled to Ft. Benning, GA for Infantry Basic Training. After graduating basic training, Jeremy attended Airborne School and the Ranger Indoctrination Program (RIP). Upon successful completion of RIP, Jeremy was assigned to the 75th Ranger Regiment, 1st Ranger Battalion in Savannah, GA where he served for 5 years as a mortar man, infantry team leader, infantry squad leader and infantry weapons squad leader. In the summer of 2000 Jeremy moved to Ft. Polk, LA to serve in the Joint Readiness Training Center as an Observer Controller.    After the terrorist attack on the World Trade Center on September 11, 2001, Jeremy answered the call to serve his country in a new capacity. In March of 2002 he volunteered for and attended the 1st Special Forces Operational Detachment - Delta (1st SFOD-D) assessment and selection. Jeremy successfully completed the selection process and moved to Ft. Bragg, NC with his wife Alyssa to begin Delta's Operator Training Course (OTC). Upon completion of OTC, Jeremy was officially assigned to the Unit and placed on an operational team. For the next 14 years, Jeremy deployed numerous times to Iraq & Afghanistan to conduct direct action missions and hostage rescue operations.    Sergeant Major Morton retired from active duty in June of 2016 and he and his family moved back to Shreveport, LA. Sergeant Major Morton's notable awards include the Afghanistan Campaign Medal with Campaign Star, The Iraq Campaign Medal with 6 Campaign Stars, Legion of Merit, Purple Heart, Bronze Star with Valor, 6 Bronze Stars, the Combat Infantryman's Badge, the United States Army Presidential Unit Citation, and the Valorous Unit Award."

Today in the History of Freedom
Episode 32: The Yellow Badge

Today in the History of Freedom

Play Episode Listen Later Sep 1, 2021 2:10


Move over, scarlet letter.

Level Up Your Life Podcast
EP 99: Aldonyia Brooks on Women Of Color with A Badge

Level Up Your Life Podcast

Play Episode Listen Later Aug 31, 2021 27:35


In the last segment of the Women of Color with A Badge, we have in the guest chair, Aldonyia Brooks. Aldonyia Brooks is the daughter of a father how was killed by senseless gun violence and her mom is mentally ill and in and out of prison. She's been abused, physically emotionally, and sexually, high school dropout, teen mom, and homeless.Today, she is a mother of a 17-year od daughter and a 3-year-old son which she believes is the most important role She received her GED, graduated from college, and is a veteran of the U.S. Armed Services.Aldonyia currently holds the position of Sheriff's Deputy Field Training Officer. She's an activist, author, and former Live PD Officer.She is unapologetically about embracing her imperfections and her greatness.Questions Asked During this EpisodeWhat is a practice you use to keep your "head Up" in the face of difficulty?What has been a key insight you have learned about yourself as a result of navigating the Covid pandemic?What advice would you give to listeners to develop the inner resolve to overcome challenges?What are common barriers women face as law enforcement officers?How have you overcome barriers to success in a male-dominated industry?And so much more ...What You'll Learn In this EpisodeThe importance of African Americans reading more books about the history of our cultureThe safety concerns law enforcement officers have to contend with day to dayThe personal experiences that inspired her to pursue a law enforcement careerThe mental attitude she takes towards succeeding as a law enforcement officerThe difference between her confidence when she was always worried about people's opinions and when she stopped worrying about other people's opinions of herThe importance of being authentic in your workplace vs codeswitching to pander to people uncomfortable with your race, gender or any other "different" factorAnd so much more ...I'm grateful for you and for your gracious time listening to the podcast. I always appreciate it if you can take a moment to rate, review, and share this show with anyone who could benefit!Contact Aldonyia BrooksFacebookLinkedInMusic Credit:Adobe SuccessSubscribe to Podcast: Apple Itunes | Spotify | Amazon TuneIn | iHeartRadioGo Be Great Podcast Intro Support the show (https://paypal.me/jackiecapersbrown?locale.x=en_US)

Obie & Ashley
Phone backups, Obie's Badge & Ex'es work out or nah?

Obie & Ashley

Play Episode Listen Later Aug 31, 2021 42:02


Packed show boiled down to the essentials! Do you back up your phone & how do you feel about Ex'es getting back together?

Path to Mastery
Is the Mod Badge Really That Important? with Jeff the Entrepreneur on Clubhouse

Path to Mastery

Play Episode Listen Later Aug 30, 2021 38:05


Jeff J Cunningham is a Real Estate Investor, Author, YouTuber, Podcast Host, Brand and Marketing Consultant, and founder of Changing Lives Marketing and Consulting. He is an investor in his brother's business, Changing Lives Financial, whose goal is for 20 million families to become financially free in the next 10 years. Losing his mom when he was young and facing all of his financial trials, makes him passionate about everyone making money around him. His older brother Jason died and his endless pursuit is to build the biggest franchise in honor of him called, KokomoJays. He currently has been asked to speak and now keynote speaks at events, as he is launching his own Changing Lives Events with his Entourage members, the ones who are connected to Collab with his mission to inspire others always Connect with Jeff: LinkedIn: https://www.linkedin.com/in/jeff-j-cunningham-5570b0126 Facebook: https://www.facebook.com/Jeffcrash Instagram: https://www.instagram.com/jefftheentrepreneur/?hl=en Website: https://www.changinglivescourse.com/entourage46465274 Connect with David: Website- http://www.davidihill.com/ Facebook- https://www.facebook.com/davidihill/ YouTube- https://www.youtube.com/user/hillteam17 LinkedIn- https://www.linkedin.com/in/davidihill Book: https://www.amazon.com/Sales-Playbook-Simple-Strategies-Close/dp/1628652861 Free Gift: https://callreluctance.davidihill.com/ Free 30-minute Coaching Call https://www.trycoaching.net Monthly Training with David- https://35callchallenge.com/ David's Monthly Article – http://www.davidihill.com/5mistakes/ FACEBOOK COMMUNITY Please follow and join my Group- https://www.facebook.com/groups/ptmastery/ OUR LEAD PROVIDER SPONSORS VULCAN7 https://www.vulcan7.com/pathtomastery/

Bears Barroom Radio Network
The Barfly Tailgate Show | Bears/Titans Recap | 53 Man Roster

Bears Barroom Radio Network

Play Episode Listen Later Aug 29, 2021 115:13


The Tailgate Crew was on had to recap the final Bears pre-season game against the Titans.  AC and Badge talked about Justin Fields play and still don't understand how he isn't the week 1 starter.   The Offensive Line clearly has some major work to do in these 2 weeks to prepare for the Los Angeles Rams on Sunday Night Football. The guys then went through the entire roster positions by position to give their thoughts on who will round out the Final 53 man roster.   Network Promotions and Shout-Outs ended the show. 

Video Theater – The Great Detectives of Old Time Radio
Video Theater 210: Man Behind the Badge: The Case of Operation Sabotage (Public Domain Video Theater)

Video Theater – The Great Detectives of Old Time Radio

Play Episode Listen Later Aug 29, 2021 29:25


Saboteurs plot against a bomber squadron. Season 2, Episode 37 Original Air Date: September 17, 1955

Level Up Your Life Podcast
EP 98 : Dr. Leigh Hicks On Women of Color with A Badge

Level Up Your Life Podcast

Play Episode Listen Later Aug 27, 2021 62:56


In the fourth segment of the Women of Color with A Badge series, we have in the guest chair, Dr. Leigh Hicks.  She says, "Your growth is bigger than the personalities around you."Dr. Hicks graduated from Walden University with a Ph.D. in Human Services, a concentration on Clinical Social Work. She has over 15 years of professional experience. She specializes in restorative justice, juveniles, mental health, human sex trafficking, domestic violence, victims advocacy, social work, law, and criminal justice. Dr. Hicks' role at Walden University is a Contributing Faculty Member in the school of counseling and social work. Her dissertation was published through ProQuest in May of 2017.In our conversation, we discuss how her work as a social worker and therapist at SC Dept. of Juvenile Justice working in the girl's program inspired her desire to see the difference between restorative justice vs retribution justice. She shares her perspectives on police reform, the benefits of community policing, how her superpower helps her to overcome challenges, juggling the demands of a law enforcement officer and being a single parent, what she learned about herself after overcoming the fear of failure,  what she believes each of us can do to be the change we want to see in the world, and so much more.Questions I Asked In this EpisodeIf you had to choose a theme song for your life, what would it be and why?What is your superpower and how has it helped you to overcome challenges and succeed?How does looking at challenges as a benefit helps us to overcome them?What inspired you to pursue a career in law enforcement?What does restorative justice look like?How did you juggle the demands of your work as a law enforcement officer and your parental responsibilities?Why are women law enforcement officers better able to de-escalate tense situations?What activities did you get involved in to serve and make her community better?What have you learned about yourself as a result of overcoming fear?And so much more ...What You Learn In this EpisodeThe superpower that equips her to overcome challenges and succeedWhat she thinks about police reform in the U.S.The benefits of community policing for communitiesWhat she did as a mental health liaison for Richland County Sheriff DepartmentWhat inspired her to start the Foot Steps 2 Success non-profit for womenHow she continues to give back to her community after resigning from her law enforcement careerWhy she believes that restorative justice is key to transforming the lives of those in the criminal justice systemAnd so much more ...Contact Dr. Leigh HicksFootsteps2SuccessLinkedInMusic Credit:Adobe SuccessSubscribe to Podcast: Apple Itunes | Spotify | Amazon TuneIn | iHeartRadioGo Be Great Podcast Intro Support the show (https://paypal.me/jackiecapersbrown?locale.x=en_US)

YCSO: Behind the Badge
YCSO Behind the Badge - Alcohol Enforcement Team

YCSO: Behind the Badge

Play Episode Listen Later Aug 27, 2021 31:52


Each month six teams with the York County Alcohol Enforcement Team (AET) work to make sure businesses in York County are not selling alcohol to those underage.

Radio Retropolis
The Dragnet Radio Podcast #110-The Big September Man

Radio Retropolis

Play Episode Listen Later Aug 27, 2021 30:58


An attractive blonde is found beaten to death in a downtown office building. A length of steel pipe wrapped in heavy paper is the only lead.  Commentary on the verisimilitude of Dragnet which set this series far above anything else at this time.

Integrative Wellness Radio
Back To The Basics: Having An Identity & A Vision ft. Brendan Vermeire

Integrative Wellness Radio

Play Episode Listen Later Aug 26, 2021 35:24


In this part two episode of The Integrative Wellness Radio, Dr. Nicole chats with Brendan Vermeire of Metabolic Solutions. The two cover their personal experience with toxics, abnormal but commonly accepted symptoms, and how they were introduced to functional medicine. Brendan provides insight on the misconception that illness is physical, when in fact it can and very often is psycho-emotional. Dr. Nicole shares a patient's story on Lyme disease, identity, and how having a future vision can affect your healing. Noteworthy Time Stamps: 2:15 Daily toxin exposure 3:26 Why Brendan got in functional medicine 7:17 “Normal” symptoms that aren't so normal 10:40 A bruise to the nervous system 19:08 Badge of honor dilemma  21:05 Lyme disease & identity 23:00 Why you need to have a vision

Level Up Your Life Podcast
EP 97: Women of Color With A Badge with Christa Williams

Level Up Your Life Podcast

Play Episode Listen Later Aug 20, 2021 55:35


In the third segment of the Women of Color with A Badge podcast series, we have in the guest chair Christa Williams. In this episode, some of the topics we discuss in this passionate conversation include community activism, supporting people's right to vote, why leadership is about service, how to build a personal brand to set yourself up for career success, her thoughts about how community leaders can build bridges to develop trusting relationships with law enforcement and her advice to women about how they can succeed in a male-dominated industry. Christa Williams is a woman of color with pride and hope in South Carolina. She is passionate about her work to improve education and representation for the citizens of the state.Christa is a candidate for the City of Columbia County Council for District 1. Her passion and dedication to improving the lives of the citizens in Columbia inspired her decision to run for political office. She completed her Bachelor's and Masters's degree at Columbia College and she's a Doctor of Education Student at Northeastern University, Boston MA.She is a commission officer for the SC Army National Guardsman and is a Captain for the SC Department of Corrections. As the President of The Rural SC-Project, her organization empowers underrepresented communities in S.C. She is a community activist who is dedicated to the citizens of South Carolina and helping the state become great for every citizen.Questions I Asked During this InterviewWhat inspired you to start The Rural SC Project?What impact did the verdict of George Floyd have on her?What are your thoughts about so many state legislatures passing laws that suppress the vote in our nation?How has your training from the SC National Guard and SC Dept. of Corrections prepared her to successfully lead The Rural SC-Project and achieve success as a Woman of Color with A Badge?What actions community leaders can take to develop trusting relationships with law enforcement communities?And so much more ...What You'll Learn In This EpisodeWhy she is so passionate about serving under-resourced communitiesThe legal procedure law enforcement officers are supposed to take when it comes to restraining suspectsThe importance of educating yourself as a voter How the culture of a law enforcement agency influences what is and isn't acceptable by leaders within the agencyThe importance of community leaders being aware of all the responsibilities of law enforcement officersCommunity leaders need to have discussions about mental health with citizensHow communities can empower themselves to create the change they want to see in their communityAnd so much more ...Contact ChristaThe Rural SC ProjectFacebookEmail: theruralscproject@gmal.comMusic Credit:Adobe SuccessSubscribe to Podcast: Apple Itunes | Spotify | Amazon TuneIn | iHeartRadioGo Be Great Podcast Intro Support the show (https://paypal.me/jackiecapersbrown?locale.x=en_US)

Warden's Watch
066 The Colebrook Murders Part II: My Badge Saved My Life

Warden's Watch

Play Episode Listen Later Aug 19, 2021 82:02


In this episode our two hosts become an interviewer and an interviewee. In 1997, a rogue gunman began a violent rampage in the town of Colebrook. One of the responding officers, Warden Wayne Saunders of New Hampshire was injured in an attempt to apprehend the subject. The badge he wore on that day deflected the bullet shot by the suspect and saved his life. In this episode Wayne tells his personal account of that day and how it affected his life. Our Sponsors:  Thin Green Line Podcast Sovereign Sportsman Solutions “A Cowboy in the Woods” Book Hunt of a Lifetime Maine's Operation Game Thief Wildlife Heritage Foundation of NH International Wildlife Crime Stoppers Here's What We Discuss: Episode dedicated to Senior Corporal Jeff Neal of Hope, Arkansas Dedicated to Scott Phillips and Leslie Lord, New Hampshire State Police Survived a critical incident in a small town A regular day with a field day the next day Report of a stolen cruiser, possibly by a kid “Turn off your blue lights” Jurisdictional issues in mind Dust hanging under a bridge pass Man with a campaign hat pointing a gun 15 yards away Cover and concealment Everything was in slow motion, yelled at people in a restaurant to leave  Backed up slow, then fast into a tree I didn't know what was going on Center of the badge was shot off Ricochet of the 7 rounds Don't my boots; sorry I wrecked the cruiser Shredded my bicep, scarred to this day Found out what happened from the news Staying in the fight even when injured From the hospital to funerals  Brothers holding me up Improving communication, switched rifles New York response team It takes a horrible incident for improvement The only woman that made me cry: physical therapist breaking down scar tissue Negative comments made me transfer Critical incident fallout; learning experience Worse for your partner to get shot than to be the victim Physical and mental pain I always wanted to be the cowboy in the woods, no one would take that for me Brought game wardens to state police with shooting pay support We're always on duty More tools available now Pack of wardens Usually not next to cruiser People hide and hide things in the woods Educate the public on what we go through Credits Hosts: Wayne Saunders and John Nores Producer: Jay Ammann Social Media/Marketing: Morgan Day Find More Here: Website Apple Podcasts Spotify Facebook Facebook Fan Page Instagram Twitter Spreadshirt Stitcher Tunein Megaphone YouTube RSS Learn more about your ad choices. Visit megaphone.fm/adchoices

Radio Retropolis
The Dragnet Radio Podcast #101-The Big Sophomore

Radio Retropolis

Play Episode Listen Later Aug 18, 2021 32:18


Neighborhood petty thievery leads to capture of teenage boy which culminates into a much more dramatic story than your usual Dragnet episode.  Commentary on yet another superb episode and the value of Dragnet in which the listener connects emotionally to our cast with another very sad tale.

PenPen Pals
S4E5: Your Thorn, My Badge (Nate) キミの棘、ボクのしるし

PenPen Pals

Play Episode Listen Later Aug 17, 2021 73:56


What's that thing humans have? They're awkward and you're not supposed to show them in public? They change during puberty... FEELINGS!!! That's it! Everybody has them in this episode, and Hiro has quite a bit more. Nate returns as he embarks on his first journey through Franxx. Find his stuff @art_by_midnite Tweet at us @penpenpalspod or email us at penpenpalspod@gmail.com

YCSO: Behind the Badge
YCSO Behind the Badge - Back To School with YCSO SROs

YCSO: Behind the Badge

Play Episode Listen Later Aug 13, 2021 35:35


On August 16, 2021 York County schools will be back in session. On this behind the badge we talk with two YCSO School Resource Officers about what parents and students need to know about the first day and the school year.

SISTERHOOD OF SWEAT - Motivation, Inspiration, Health, Wealth, Fitness, Authenticity, Confidence and Empowerment
Ep 321 - Let It Rip Friday: Push Past Hard and Earn Your Badge of Sweat

SISTERHOOD OF SWEAT - Motivation, Inspiration, Health, Wealth, Fitness, Authenticity, Confidence and Empowerment

Play Episode Listen Later Aug 13, 2021 24:20


On this week's Let It Rip Friday, Linda joins us from her car to share insight on how to push past hard, and earn your badge of sweat.

WTF Just Happened Today
Day 204: "A badge of honor."

WTF Just Happened Today

Play Episode Listen Later Aug 11, 2021 3:30


Wednesday, August 11, 2021 Subscribe: Get the Daily Update in your inbox for free 1/ The Senate passed a $3.5 trillion budget plan that includes a sweeping expansion of the social safety net. The 92-page blueprint, which would expand Medicaid, provide free preschool and community college, and fund climate change programs, passe... Visit WTF Just Happened Today? for more news and headlines, brought to you by Matt Kiser. The WTFJHT Podcast is narrated and produced by Joe Amditis.

YCSO: Behind the Badge
YCSO Behind the Badge - Polygraphs

YCSO: Behind the Badge

Play Episode Listen Later Aug 6, 2021 27:21


The old saying "liar liar pants on fire" doesn't work in the real world of polygraphs at the YCSO.

Four Finger Discount (Simpsons Podcast)
Poppa's GotA Brand New Badge (S13E22)

Four Finger Discount (Simpsons Podcast)

Play Episode Listen Later Jul 29, 2021 79:43


After Springfield breaks out in a riot, Homer starts his own security company to help keep the city safe. A really fun season finale that features a great Sopranos cameo! Enjoy the show? Show your support by becoming a FFD Patron at patreon.com/fourfingerdiscount to get instant access to hours of free podcasts, early access to all of our shows, access to our exclusive Facebook group and more.