POPULARITY
Categories
72 episodes with Harm
31 episodes with Harm
24 episodes with Harm
14 episodes with Harm
10 episodes with Harm
22 episodes with Harm
13 episodes with Harm
11 episodes with Harm
27 episodes with Harm
8 episodes with Harm
11 episodes with Harm
12 episodes with Harm
14 episodes with Harm
8 episodes with Harm
13 episodes with Harm
12 episodes with Harm
7 episodes with Harm
7 episodes with Harm
6 episodes with Harm
7 episodes with Harm
8 episodes with Harm
7 episodes with Harm
11 episodes with Harm
27 episodes with Harm
6 episodes with Harm
6 episodes with Harm
4 episodes with Harm
6 episodes with Harm
12 episodes with Harm
8 episodes with Harm
15 episodes with Harm
9 episodes with Harm
5 episodes with Harm
13 episodes with Harm
10 episodes with Harm
17 episodes with Harm
7 episodes with Harm
6 episodes with Harm
4 episodes with Harm
4 episodes with Harm
8 episodes with Harm
5 episodes with Harm
5 episodes with Harm
13 episodes with Harm
8 episodes with Harm
8 episodes with Harm
9 episodes with Harm
4 episodes with Harm
11 episodes with Harm
8 episodes with Harm
9 episodes with Harm
3 episodes with Harm
6 episodes with Harm
6 episodes with Harm
6 episodes with Harm
3 episodes with Harm
7 episodes with Harm
9 episodes with Harm
5 episodes with Harm
4 episodes with Harm
11 episodes with Harm
4 episodes with Harm
5 episodes with Harm
3 episodes with Harm
6 episodes with Harm
16 episodes with Harm
7 episodes with Harm
5 episodes with Harm
6 episodes with Harm
3 episodes with Harm
3 episodes with Harm
3 episodes with Harm
3 episodes with Harm
6 episodes with Harm
6 episodes with Harm
6 episodes with Harm
7 episodes with Harm
5 episodes with Harm
4 episodes with Harm
4 episodes with Harm
5 episodes with Harm
4 episodes with Harm
9 episodes with Harm
5 episodes with Harm
4 episodes with Harm
5 episodes with Harm
5 episodes with Harm
5 episodes with Harm
3 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
5 episodes with Harm
7 episodes with Harm
3 episodes with Harm
6 episodes with Harm
2 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
5 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
4 episodes with Harm
9 episodes with Harm
3 episodes with Harm
4 episodes with Harm
5 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
7 episodes with Harm
5 episodes with Harm
3 episodes with Harm
2 episodes with Harm
7 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
8 episodes with Harm
2 episodes with Harm
4 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
8 episodes with Harm
5 episodes with Harm
3 episodes with Harm
3 episodes with Harm
8 episodes with Harm
3 episodes with Harm
4 episodes with Harm
2 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
7 episodes with Harm
3 episodes with Harm
3 episodes with Harm
2 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
4 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
Harm reduction for eating disorders is often misunderstood, under-discussed, and sometimes controversial — yet it's transforming the way we think about treatment and care. In this episode, Sam and Laura are joined by Brenda Velissaris, LPC-S, CEDS-C, to explore how a harm reduction approach to eating disorders can meet people where they are, reduce immediate risks, support autonomy, and improve quality of life — all while holding hope for ongoing recovery. You'll learn how harm reduction strategies can complement or provide alternatives to traditional treatment, offering new possibilities, tools, and compassionate support for those who don't fully benefit from or feel stuck in conventional approaches. If you enjoy our show, please rate, review, subscribe, and tell your friends and colleagues! Interested in being a guest on All Bodies. All Foods.? Email podcast@renfrewcenter.com for a chance to be featured. All Bodies. All Foods. is a podcast by The Renfrew Center. Visit us at: https://renfrewcenter.com/
Reason's Robby Soave and Elizabeth Nolan Brown go head to head with Emily Jashinsky and Ryan Grim from Breaking Points in a thought-provoking debate about Big Tech.
Dr Kirk Honda interviews Ruwan Meepagala about this book titled Orgsm: A Memoir, which is about his experiences inside the so-called sex cult of OneTaste. December 17, 2025This episode is sponsored by BetterHelp. Give online therapy a try at betterhelp.com/KIRK to get 10% off your first month.00:00 Introducing Ruwan Meepagala and Orgsm, a Memoir15:44 What was Ruwan's experience in OneTaste?44:56 The dark side of OneTaste1:13:51 Why were criminal charges brought up? 1:17:32 Why did Ruwan leave? 1:26:29 Harm and recovery Become a member: https://www.youtube.com/channel/UCOUZWV1DRtHtpP2H48S7iiw/joinBecome a patron: https://www.patreon.com/PsychologyInSeattleEmail: https://www.psychologyinseattle.com/contactWebsite: https://www.psychologyinseattle.comMerch: https://psychologyinseattle-shop.fourthwall.com/Instagram: https://www.instagram.com/psychologyinseattle/Facebook Official Page: https://www.facebook.com/PsychologyInSeattle/TikTok: https://www.tiktok.com/@kirk.hondaThe Psychology In Seattle Podcast ®Trigger Warning: This episode may include topics such as assault, trauma, and discrimination. If necessary, listeners are encouraged to refrain from listening and care for their safety and well-being.Disclaimer: The content provided is for educational, informational, and entertainment purposes only. Nothing here constitutes personal or professional consultation, therapy, diagnosis, or creates a counselor-client relationship. Topics discussed may generate differing points of view. If you participate (by being a guest, submitting a question, or commenting) you must do so with the knowledge that we cannot control reactions or responses from others, which may not agree with you or feel unfair. Your participation on this site is at your own risk, accepting full responsibility for any liability or harm that may result. Anything you write here may be used for discussion or endorsement of the podcast. Opinions and views expressed by the host and guest hosts are personal views. Although, we take precautions and fact check, they should not be considered facts and the opinions may change. Opinions posted by participants (such as comments) are not those of the hosts. Readers should not rely on any information found here and should perform due diligence before taking any action. For a more extensive description of factors for you to consider, please see www.psychologyinseattle.com
[This episode originally aired on February 21, 2023] Is there a way to make a sane relationship with our bad deeds and our regrets, to learn from them and to move on from them? • it's not easy to face up to all that we've done; it's not easy to find a way between wallowing in guilt and evading responsibility • in the Buddhist monastic traditions, there is a practice that addresses this issue • it's assumed that over time we can't avoid causing harm, but this practice provides a way of directly facing and working with the harm we have caused • the starting point is remorse; we feel bad about what we have done, and we want to do something about it • remorse leads us to the second step: acknowledging our harmful actions, confessing them, and seeking to purify them • the third step is making amends, counteracting the harm we've done by doing something beneficial, which could include asking for forgiveness • acknowledging and working with our mistakes is so much better than just holding onto a big pool of regret • we can include everything, all of our experiences, to the enrichment of our journey.
One on One Video Call W/George https://tidycal.com/georgepmonty/60-minute-meetingSupport the show:https://www.paypal.me/Truelifepodcast?locale.x=en_USThe Lila Code: https://orcid.org/0009-0008-4612-3942
Kipster wil bewijzen dat duurzame landbouw werkt. Met diervriendelijke kippen, reststromen als voer en nu ook circulair brood, bouwt het bedrijf aan een compleet gesloten keten.Deze aflevering in het kort:☑️ Kipster combineert kippen, eieren én brood in een circulaire keten☑️ De voorwaarden van een duurzaam landbouwmodel☑️ Natuurbranden zorgen voor meer vervuiling dan eerder gedachtKipster in Venray geldt als één van de meest innovatieve en diervriendelijke kippenhouderijen ter wereld. Het bedrijf werkt volledig circulair: kippen krijgen voer op basis van reststromen, de haantjes worden niet vernietigd maar opgefokt, en eieren én vlees worden lokaal verkocht. Recent voegde Kipster er zelfs brood aan toe. Het graan daarvoor wordt naast de kippenstal verbouwd, met kippenmest als meststof, en het brood wordt vervolgens verkocht via Lidl. Reststromen uit het bakproces gaan weer terug het kippenvoer in. Zo ontstaat een gesloten kringloop waarin voedselproductie, diervriendelijkheid en klimaatimpact allemaal worden meegenomen.
We all know how damaging loud or constant sounds can be to our hearing - but there are a lot of factors that can impact hearing that most of us would never consider. Things like smoking - even secondhand smoke, cold wind, too much water - countless things, most of which we'd hardly consider to be dangerous. LISTEN ABOVESee omnystudio.com/listener for privacy information.
The government has announced the overhaul of the Resource Management Act (RMA), which will be replaced by two different bills, the Planning Bill and the Natural Environment Bill. The RMA is set to be fully replaced by 2029. The RMA, which has been in effect for 34 years, is polarising across the political spectrum. In announcing the reforms, RMA Reform Minister, Chris Bishop, says that “pretty much everything” will be quicker and less costly under the new regime. For our weekly catch-up with the ACT Party, News and Editorial Director and Monday Wire Host Joel spoke to MP Simon Court about this overhaul of the RMA. They also discussed The Education and Workforce Committee's interim report on the harms young people experience online, with a majority recommending a ban on social media for under-16-year-olds. But first, they discussed the overhaul of the RMA.
Credit Card Interest Rate Caps Would Harm Low-Income Borrowers: Colleague Veronique de Rugy criticizes proposals by Senators Sanders and Ocasio-Cortez to cap credit card interest rates at 10 percent, arguing price controls will force companies to reduce risk, ultimately denying credit to the low-income borrowers the bill aims to protect SP 1954.
Actual conservatism, not the fake stuff that is about protecting banks and corpo interests.Sources:https://www.returntotradition.orgorhttps://substack.com/@returntotradition1Contact Me:Email: return2catholictradition@gmail.comSupport My Work:Patreonhttps://www.patreon.com/AnthonyStineSubscribeStarhttps://www.subscribestar.net/return-to-traditionBuy Me A Coffeehttps://www.buymeacoffee.com/AnthonyStinePhysical Mail:Anthony StinePO Box 3048Shawnee, OK74802Follow me on the following social media:https://www.facebook.com/ReturnToCatholicTradition/https://twitter.com/pontificatormax+JMJ+#popeleoXIV #catholicism #catholicchurch #catholicprophecy#infiltration
Actual conservatism, not the fake stuff that is about protecting banks and corpo interests.Sources:https://www.returntotradition.orgorhttps://substack.com/@returntotradition1Contact Me:Email: return2catholictradition@gmail.comSupport My Work:Patreonhttps://www.patreon.com/AnthonyStineSubscribeStarhttps://www.subscribestar.net/return-to-traditionBuy Me A Coffeehttps://www.buymeacoffee.com/AnthonyStinePhysical Mail:Anthony StinePO Box 3048Shawnee, OK74802Follow me on the following social media:https://www.facebook.com/ReturnToCatholicTradition/https://twitter.com/pontificatormax+JMJ+#popeleoXIV #catholicism #catholicchurch #catholicprophecy#infiltration
Send us a textIn this powerful episode of the Crisis in Education Podcast, Dr. Paul “Paulie” Gavoni sits down with Bonnie and Thomas Liotta, founders of Creating Champions For Life, for an unfiltered conversation about behavior, safety, and the cost of getting it wrong.The discussion centers on a reality educators and parents can no longer ignore: when systems rely on reactive, punishment-based approaches, everyone loses—students, families, and staff. Drawing from decades of experience and thousands of transformed families, the Liottas challenge conventional behavior management practices and offer a proactive, skills-based alternative grounded in prevention, regulation, and human dignity.Together, Paulie, Bonnie, and Thomas unpack why restraint-driven cultures persist, how fear and misinformation shape decision-making, and what happens when adults are trained to teach life skills instead of managing crises. The conversation connects behavior science, parenting, education, and leadership through one unifying question: What would change if we focused on building capacity instead of controlling behavior?This episode is a must-listen for educators, administrators, behavior analysts, parents, and leaders who want safer environments, better outcomes, and approaches that actually work in the real world.About the GuestsBonnie and Thomas Liotta are the founders of Creating Champions For Life, where they have helped over 3,000 children achieve a 90% behavioral transformation rate and a 78% medication elimination rate across hundreds of families.After Bonnie's own children struggled with behavioral diagnoses, she discovered Thomas's methodology and experienced a complete transformation at home. Today, they challenge traditional parenting and behavior models by teaching families how to eliminate challenging behavior through proactive life-skills development, not punishment. Combined, they bring over 60 years of experience in child development and personal growth.Resources Mentioned in This Episode
All this week we've been looking at some of the latest data from the Pew Research Center on how parents of children ages twelve and under are managing the realities of life in a smartphone saturated world. One finding that should cause us to pause in our parenting steps is this: parents overwhelmingly think using social media does more to harm than benefit their kids. In fact, eighty-percent of parents of kids twelve and under say that there are more harms than benefits from social media. This begs a question: If, in fact, there are any harmful aspects related to social media use, why are we allowing our kids to engage with social media through their smartphones and screens? Parents, the Apostle Paul tells us in the book of Ephesians that our high calling is to nurture and raise our children in the admonition of the Lord. We need be about the work of protecting our children from harm and providing for their well-being. Remember this as you think about your kids and social media.
It's a day in the life of Harmony and the boys are stoked! Join us as we discuss camel butchering, desk crunches, and healthy workplace environments for former murderers. It's Angel S5E9: Harm's Way! IG & FB: @boozeandbuffy Email: boozeandbuffy@gmail.com Art Credit: Mark David Corley Music Credit: Grace Robertson
TikTok reshapes the way people talk about bodies, beauty, and wellness. What looks like gentle self care often hides restrictive eating patterns, thinness pressure, and aesthetic rules that reward shrinking. In this episode, Dr. Marianne Miller explores how TikTok rebrands diet culture by disguising restriction inside trends like “anti bloat,” “glow up,” “clean girl body,” and “body recomposition.” Dr. Marianne explains why these trends spread quickly, why they create a strong pull for people with eating disorders, and why neurodivergent viewers may feel especially drawn to routines that promise control or calm. She describes how glow up narratives romanticize disappearance and how thinness becomes a transformation story. You will learn how to identify coded diet language and how to stay grounded while moving through online spaces that promote harmful messaging. What You Will Learn in This Episode 1. How TikTok Rebrands Diet Culture Dr. Marianne explains how “anti bloat” routines and glow up challenges present restriction as wellness. She highlights how these messages look soft and soothing even though they pressure people to shrink and control their bodies. 2. How Coded Restriction Language Shows Up Online You will learn how creators use soothing audio, soft visuals, and vague terms to disguise patterns that mirror disordered eating. Dr. Marianne names the phrases that quietly promote thinness. 3. Why Neurodivergent Viewers and People With Eating Disorders Feel Drawn In Structured routines and visuals can feel comforting or predictable. Dr. Marianne describes how this pull can feel stronger for neurodivergent listeners or anyone living with long-term food struggles. 4. How Glow-Up Culture Romanticizes Shrinking Dr. Marianne explores how glow up narratives frame thinness as success, transformation, or emotional strength. These stories reward disappearance and pressure people to strive for smaller bodies. 5. Intersectionality and Harmful Messaging Dr. Marianne names the ways thinness aesthetics reinforce cultural pressures for people in larger bodies, people of color, neurodivergent individuals, transgender and nonbinary people, and anyone who already experiences scrutiny or marginalization. 6. How to Strengthen Your Relationship With TikTok You will learn practical strategies to identify harmful patterns, curate your feed, follow body liberation voices, and stay centered in your own needs while using the platform. Content Caution This episode includes discussion of thinness trends, restrictive routines, and coded dieting messages on TikTok. If you feel overwhelmed or activated, please pause and return when you feel grounded. Who This Episode Supports This episode supports: • people recovering from eating disorders • neurodivergent listeners who feel drawn to routines or calming visuals • people in larger bodies who feel erased by glow up narratives • trauma survivors who feel pulled toward control-based content • clinicians, parents, and helpers who want to understand the pressures their clients or teens face online • anyone curious about how diet culture hides inside wellness language Resources Listeners may find support through: • body liberation and fat liberation educators • research on social media and disordered eating • neurodivergent-affirming eating disorder resources • trauma-informed recovery frameworks Related Episode SkinnyTok & Anorexia: How Harmful Trends Thrive Despite TikTok's Ban with Jen Tomei @askjenup on Apple and Spotify. Work With Dr. Marianne Miller Learn more about therapy, coaching, binge eating support, ARFID resources, and upcoming clinician trainings at drmariannemiller.com. Explore the blog, podcast show notes, and all available offerings.
The Police Ombudsman Fiosrú has publishsed its first report on Deaths and Serious Harm relating to an Garda Siochana since replacing GSOC. Our reporter Eleanor Burnhill was at today's presentation by the Police Ombudsman Emily Logan.
In this episode of The Healthy CEO, host Jason Wright talks with Dr. John Osborne, a leading expert in preventive cardiovascular care. They discuss the critical importance of early detection of heart disease using advanced tools like cardiac CT and AI technology. Dr. Osborne elaborates on the modifiable and non-modifiable risk factors for heart disease, including high blood pressure, cholesterol, tobacco use, and family history. He also emphasizes the significant role of diet, exercise, and stress management in maintaining cardiovascular health. This conversation sheds light on the future of preventive cardiology and how modern medicine can help individuals live healthier, longer lives.00:00 Introduction to The Healthy CEO00:31 Sponsor Message: Authentic Health01:28 Introducing Dr. John Osborne01:52 The Importance of Preventive Cardio Care02:36 Dr. Osborne's Background and Achievements04:47 The Shift Towards Proactive Heart Health05:57 The Role of Cardiac CT and AI in Early Detection14:06 Challenges in Current Cardiovascular Screening20:07 The Future of Preventive Cardiology23:22 The Impact of Lifestyle on Heart Health40:35 The Harm of Smoking: One Cigarette vs. A Pack41:52 Understanding High Blood Pressure42:05 The Importance of Home Blood Pressure Monitoring44:40 The Impact of High Blood Pressure on Longevity45:19 Challenges in Treating High Blood Pressure46:51 AI in Cardiovascular Health50:42 The Role of Cholesterol in Heart Disease52:25 Statins and Other Cholesterol-Lowering Tools01:00:03 Exercise and Diet for Heart Health01:06:30 Non-Modifiable Risk Factors and Family History01:09:08 Inflammatory Conditions and Heart Disease01:11:43 Final Thoughts and Preventative Cardiology
Emily Logan- Police Ombudsman
Ending intimate partner and gender violence means supporting those who use harm to change. In this episode we explore what that looks like in queer relationships with Gus and Vincent from Thorne Harbour Health’s family violence counselling team. Check out our other JOY Podcasts for more on LGBTIQ+ health and wellbeing at joy.org.au/wellwellwell. If there's something you'd like us to explore on the show, send through ideas or questions at wellwellwell@joy.org.au Find out more about LGBTIQ+ services and events in Victoria and South Australia at thorneharbour.org and samesh.org.au.
If you've ever questioned why your grief feels different, episode 394 of the Grief and Happiness podcast is for you. Award-winning author and grief educator Theo Boyd shares the life-shifting losses that shaped her work and the signs that helped her forward. She explains why comparing grief adds to the pain and why sadness is not a disorder. Her story offers a clear, hopeful reminder that healing begins when you honor your own way through loss.In This Episode, You Will Learn:(01:02) How a tragic farm accident changed Theo's life overnight(02:40) Why journaling became her first lifeline through overwhelming grief(03:55) The moment she realized her notes needed to become a grief book(04:50) How compounded loss shaped My Grief Is Not Like Yours(06:10) The story behind her second book Hope All the Way and the signs that inspired it(09:03) What her national grief study reveals about America's hidden grief crisis(11:37) Why society's discomfort with sadness harms grievers(12:47) The real meaning of “complicated grief” and why labels can be damaging(14:22) How early counseling support helped her survive the darkest period(17:22) How signs and moments of meaning helped her rediscover purposeThelizabeth “Theo” Boyd is an award-winning author, speaker, podcast host, and certified grief educator whose work centers on validating the many forms of loss. A former high-school English and creative writing teacher, she turned to journaling after a series of life-altering events, including the accidental death of her mother, the sudden loss of her longtime counselor, the end of her marriage, and later her father's suicide. These experiences shaped her first book, My Grief Is Not Like Yours, and her upcoming release Hope All the Way, which also incorporates findings from her national study on the state of grief in America.In her conversation with Emily, Theo reflects on how writing became both an anchor and a purpose after her world collapsed. She explains why grief must be witnessed, why comparisons rarely comfort, and how meaning deepens into purpose only when it serves others. Theo also shares the powerful signs she's received from her parents, the importance of normalizing sadness instead of pathologizing it, and the urgent need to address the country's grief crisis. Her perspective offers listeners a grounded, hope-filled reminder that healing grows from honesty, connection, and staying open to moments of grace along the way.Connect with Theo Boyd:WebsiteFacebookLinkedInInstagramYouTubeLet's Connect: WebsiteLinkedInFacebookInstagramTwitterThe Grief and Happiness Alliance Hosted on Acast. See acast.com/privacy for more information.
Priscilla Ward joins Dr. Sandie Morgan as they explore how true healing happens not through fixing or rescuing, but by learning to sit in discomfort, lead with curiosity, and create consistent communities where survivors can feel safe enough to begin their journey at their own pace. https://youtube.com/shorts/Jsi6YO3zobw?feature=share Priscilla Ward Priscilla Ward, LCSW, is the Founder and Clinical Director of Compass Rose Psychotherapy in Fullerton, California. With over 18 years in the helping profession and 15 years of clinical experience, she has dedicated her career to supporting youth, young adults, and families through trauma, anxiety, substance use, and grief. A graduate of the University of Southern California with a Master's in Social Work, Priscilla brings extensive experience from nonprofit agencies, community mental health clinics, correctional facilities, and school-based programs. She has led mental health teams for the Orange County Department of Education, developing trauma-responsive programs and training professionals in high-stress environments. Her bilingual Spanish fluency and cultural responsiveness make her a trusted ally across diverse communities. Beyond direct practice, Priscilla serves as a consultant and trainer, equipping educators, faith leaders, law enforcement personnel, and mental health professionals with trauma-informed, harm reduction, and motivational interviewing frameworks. Key Points People heal in community and relationship, not in isolation, and this healing process is rarely linear—it's complex and messy, especially for those who have experienced trauma. The shift from "what's wrong with this person" to "what happened to this person" is foundational to trauma-informed care and creates space for dignity and compassion over judgment. Harm reduction is a philosophy grounded in meeting people where they are, honoring their dignity even when they aren't ready to stop certain behaviors, and recognizing that small steps matter because keeping people alive and safe creates opportunities for future healing. Faith communities can love people well by learning to sit in discomfort and resist the urge to fix or rescue, instead focusing on building belonging without requiring behavioral compliance as a prerequisite. Understanding the stages of change (pre-contemplation, contemplation, preparation, action, maintenance, and sometimes relapse) helps helpers meet survivors appropriately at each stage rather than imposing expectations they're not ready for. Secondary trauma and burnout are real costs of caring, and taking care of our own wellness is critically important because we need to be healthy people in the room to truly serve others without reinforcing harm. Trust is the bridge for change, and consistency creates safety that literally rewires the brain—centering connection over correction leads to systemic change in how we support survivors. Listening to voices of lived experience is essential; helpers should ask "what do you need" rather than assuming they know what survivors need. Resources Compass Rose Psychotherapy Transcript [00:00:00] Priscilla Ward: what harm reduction looks like in my community might be very different than yours, but the spirit of harm reduction can be applied. Anywhere and everywhere. [00:00:11] Delaney: You know that uncomfortable space where things aren't neat or solved, what if that's where the real healing starts? Today's conversation leans into that gray area. The space where our instinct to fix meets the deeper need to simply be present. [00:00:25] When we let go of control and step into curiosity, we make room for safety, dignity, and real connection. That kind of community can change everything. Hi, I'm Delaney Menninger. I'm a student here at Vanguard University and I help produce this show. Today, Sandy talks with Priscilla Ward, a licensed clinical social worker who trains faith leaders and community team...
In this episode, we talk with Harm Goris about Thomas Aquinas's views of free will and human agency.Harm's website: https://tilburguniversity.academia.edu/HarmGorisHarm's chapter on Aquinas can be found in the Routledge Companion to Free Will.Twitter: https://twitter.com/thefreewillshowInstagram: https://www.instagram.com/thefreewillshow/?hl=enFacebook: https://www.facebook.com/The-Free-Will-Show-105535031200408/
We’re nervous. We’re excited. We’re nervous and excited. Because it’s Mary freaking Fowler day.
Jacob Moshokoa, in for CapeTalk’s Sara-Jayne Makwala King, is joined on Weekend Breakfast by Dr Marieke Theron, South African Medical Research Council Senior Scientist. Listen live on Primedia+ Saturdays and Sundays between 07:00 and 10:00am (SA Time) to Weekend Breakfast with Sara-Jayne Makwala-King broadcast on CapeTalk https://buff.ly/NnFM3Nk For more from the show go to https://buff.ly/AgPbZi9 or find all the catch-up podcasts here https://buff.ly/j1EhEkZ Subscribe to the CapeTalk Daily and Weekly Newsletters https://buff.ly/sbvVZD5 Follow us on social media: CapeTalk on Facebook: https://www.facebook.com/CapeTalk CapeTalk on TikTok: https://www.tiktok.com/@capetalk CapeTalk on Instagram: https://www.instagram.com/ CapeTalk on X: https://x.com/CapeTalk CapeTalk on YouTube: https://www.youtube.com/@CapeTalk567 See omnystudio.com/listener for privacy information.
Bryan Kohberger—the man who pleaded guilty to the brutal murders of four University of Idaho students—is reportedly considering extreme measures behind bars.See omnystudio.com/listener for privacy information.
You can't let it go until you know what it is. For all who have suffered satanic abuse, targeting, stalking and those who have lost their lives, the ones who remained behind.
You can't let it go until you know what it is. For all who have suffered satanic abuse, targeting, stalking and those who have lost their lives, the ones who remained behind.
Du lytter til en gammel episode av Harm og Hegseth. Morten og Vegard spiller inn episode nummer 500! De blir overrasket i studio med ballonger og en litt spesiell kake. Alt fra Harm og Hegseth hører du eksklusivt hos Podme.
You can't let it go until you know what it is. For all who have suffered satanic abuse, targeting, stalking and those who have lost their lives, the ones who remained behind.
Thursday, December 4th, 2025Today, the Pentagon knew there were survivors of the September 2nd boat strike; Ghislaine Maxwell is going to file a habeas petition challenging her incarceration and she' s worried the release of the Epstein Files will be damaging to her cause; Nancy Mace is considering following Marjorie Taylor Greene's lead and resigning before the end of her term in the House; the Department of Defense Inspector General found that Hegseth's Signal chat put troops in harm's way; Democrats swung 13 points with every county moving left in the special election for Tennessee's 7th Congressional District; the government is inviting employees to voluntarily disclose their disabilities; the House Judiciary Republicans have refused Jack Smith's demand for public testimony and have issued a subpoena to hold questioning behind closed doors; Judge Beryl Howell has barred the Trump administration from making warrantless arrests of immigrants in DC unless they're deemed a flight risk; the Speaker of the Virginia State House said the legislature is considering a 10D 1R congressional map; and Allison delivers and your Good News. Dana is out and about.Thank You, WildGrainGet $30 off your first box + free Croissants in every box. Go to Wildgrain.com/DAILYBEANS to start your subscription.Thank You, CBDistilleryUse promo code DAILYBEANS at CBDistillery.com for 25% off your purchase. MAGA Can't Spin Out of War Crimes! | ALLISON GILL AND THE LEFT HOOK WITH WAJAHAT ALISubscribe to MSW Media's YouTube Channel - YouTubeStoriesPentagon knew boat attack left survivors but still launched a follow-on strike, AP sources say | AP NewsPentagon watchdog finds Hegseth risked the safety of U.S. forces with use of Signal | NPRRepublican Anger Erupts at Johnson as Party Frets About Future | The New York TimesFederal Judge Bars Some Warrantless Immigration Arrests in D.C. | The New York TimesGood TroubleIf immigrants could attend their hearing over zoom, they wouldn't be at risk by just following the law and attending their immigration hearing.Petition for virtual court hearings:Petition · Stop ICE kidnappings at courts — demand virtual court hearings now! - United States · Change.org→No Contract, No Coffee→AACN Dept. of Education Proposed Limitation of Student Loan Access for Nursing→Red, Wine and Blue active North Carolina Community Trouble Nation→Mutual Aid Relief Fund, Mutual Aid Hub, GiveDirectly.org/snap→Group Directory - The Visibility Brigade: Resistance is Possible→Vote Yes 836 - Oklahoma is gathering signatures→How to Organize a Bearing Witness Standout→Find Your Representative | house.gov, Contacting U.S. SenatorsJoin Dana and The Daily Beans and support on Giving TuesdayGiving Tuesday - Support the work of the Human Rights Campaign, the nation's largest LGBTQ+ civil rights organization - The Daily BeansFrom The Good News100 Organizations Supporting Trans People in All 50 States | Them.usNational LGBT Resource Guide for Queer And Transgender OrganizationsPetition · Stop ICE kidnappings at courts — demand virtual court hearings now! - United States · Change.orgMan Cave - Timothy Mooney Repertory Theatre→Please submit your own Good Trouble and/or Good News.Our Donation LinksNational Security Counselors - Donate, MSW Media, Blue Wave CA Victory Fund | ActBlue, WhistleblowerAid.org/beansFederal workers - email AG at fedoath@pm.me and let me know what you're going to do, or just vent. I'm always here to listen.Dr. Allison Gill - Substack, BlueSky , IG, Twitter, MSW Media - YouTubeDana Goldberg - The 2025 Out100, BlueSky, Twitter, IG, facebook, danagoldberg.comMore from MSW Media - Shows - MSW Media, Cleanup On Aisle 45 pod, The Breakdown | SubstackReminder - you can see the pod pics if you become a Patron. The good news pics are at the bottom of the show notes of each Patreon episode! That's just one of the perks of subscribing! patreon.com/muellershewrote Our Donation LinksNational Security Counselors - DonateMSW Media, Blue Wave California Victory Fund | ActBlueWhistleblowerAid.org/beansFederal workers - feel free to email AG at fedoath@pm.me and let me know what you're going to do, or just vent. I'm always here to listen. Find Upcoming Actions 50501 Movement, No Kings.org, Indivisible.orgDr. Allison Gill - Substack, BlueSky , TikTok, IG, TwitterDana Goldberg - BlueSky, Twitter, IG, facebook, danagoldberg.comCheck out more from MSW Media - Shows - MSW Media, Cleanup On Aisle 45 pod, The Breakdown | SubstackShare your Good News or Good TroubleMSW Good News and Good TroubleHave some good news; a confession; or a correction to share?Good News & Confessions - The Daily Beanshttps://www.dailybeanspod.com/confessional/ Listener Survey:http://survey.podtrac.com/start-survey.aspx?pubid=BffJOlI7qQcF&ver=shortFollow the Podcast on Apple:The Daily Beans on Apple PodcastsWant to support the show and get it ad-free and early?The Daily Beans | SupercastThe Daily Beans & Mueller, She Wrote | PatreonThe Daily Beans | Apple Podcasts Hosted by Simplecast, an AdsWizz company. See pcm.adswizz.com for information about our collection and use of personal data for advertising.
In this Clinician's Corner episode, Clarissa and Molly dive into what they lovingly (and accurately) call the "Hella-Days"—that stretch from early fall through New Year's where routines disappear, food is everywhere, emotions are high, and nervous systems are fried. Together, they unpack why this season is so activating for people with food addiction and nervous system sensitivity, and how to navigate it with values, boundaries, and a whole lot of self-compassion—whether you're surrounded by family or spending the holidays on your own. In This Episode Clarissa & Molly explore: Why the holidays can feel like the "Holiday Hunger Games" and "12 Days of Dysregulation" How the nervous system responds to the build-up from September to New Year's Using values as your North Star for holiday decisions Boundary tools and scripts for parties, family gatherings, and food pushers Why holiday food environments are an "engineered stressor" (hello, peppermint-everything marketing) Strategies for: Going to events without abandoning your recovery Deciding when not to go Coping with loneliness, isolation, and dark evenings Harm reduction during high-exposure events ("good, better, best" thinking) How to re-imagine your holiday story over time instead of chasing perfection Ideas for folks who love the holidays (Clarissmas) and folks who… don't (Molly
Protecting children from the harmful side of social media has been a years-long fight, but Congress may finally be taking action. Today we hear about one mother's determination to bring change in memory of her daughter. Meanwhile, experts will offer research assistance to state legislators next session. Then, they followed the rules set up by the federal government, but still face deportation. It's just one development in the immigration debate affecting thousands of people in Colorado. And, he's the only Colorado native to play in the Negro Baseball League. Now, a century later he finally gets his due.
Send the show a text message!In this episode of the Space Between Podcast, Renae Lipsmeyer invites Caroline Markel to co-host and share her powerful story of overcoming domestic violence and abuse. Caroline discusses her journey of healing, the role of Dave Matthews Band community in her recovery, and the importance of addressing the normalization of violence. The conversation touches on the challenges of reporting abuse, the lack of support from authorities, and the innovative resources available through Safe in Harm's Way. Show Notes:Caroline Markel is the CEO and Founder of Safe In Harm's Way, a Kansas City-based nonprofit and an online secure resource for people navigating the sadness, worries, lies, screaming, fear, and pain of domestic violence. Premiering in Times Square, and spreading across the country, Caroline and her team launched two unique campaigns for diversified communities related to domestic violence, achieving one billion impressions and opportunities for immediate and actionable help. As CEO and Founder of Epizon Strategy Solutions, Caroline and her team create tailor-made solutions for employers within diversity, equity, and inclusion criteria related to profit, safety, retention, reward, and recruitment.As a survivor of domestic violence, plus revival from a death experience, Caroline uses storytelling to evoke change and has been featured on Oprah, Forbes, PBS, NPR, Ms. Magazine, M+M Magazine, national and regional television, and podcasts as an initiator to disrupt complacency within the domestic violence arena and overcoming adversity.Links from Episode:Caroline Markel Email: caroline@safeinharmsway.orgResources/Support: www.safeinharmsway.orgSupport the showTo share your DMB fan journey, email Renae: renae@thespacebetweenpodcastDMB.com
For the latest Whisper in the Wings from Stage Whisper, we welcomed on the actor William Franke and the director Illana Stein to talk about two shows, The Endgame and Don't Harm the Animals. theses works are being presented as a benefit reading for New Perspectives Theatre Company. The powerful works and the powerful subject matter were incredible to talk about. So be sure you hit play and come out to support this wonderful organization and artists today!The Endgame and Don't Harm the Animals by Joanna PickeringA Benefit Reading for New Perspectives Theatre Company December 10th at 7pm@ New Perspective StudioTickets and more information are available at newperspectivestheatre.org And be sure to follow our guests to stay up to date on all their upcoming projects and productions: newperspectivestheatre.org @illananyc @williamfrankenycwilliamfranke.com
Learn more about your ad choices. Visit megaphone.fm/adchoices
LESSON 337My Sinlessness Protects Me From All Harm.My sinlessness ensures me perfect peace, eternal safety, everlasting love, freedom forever from all thought of loss; complete deliverance from suffering. And only happiness can be my state, for only happiness is given me. What must I do to know all this is mine? I must accept Atonement for myself, and nothing more. God has already done all things that need be done. And I must learn I need do nothing of myself, for I need but accept my Self, my sinlessness, created for me, now already mine, to feel God's Love protecting me from harm, to understand my Father loves His Son; to know I am the Son my Father loves.You Who created me in sinlessness are not mistaken about what I am. I was mistaken when I thought I sinned, but I accept Atonement for myself. Father, my dream is ended now. Amen.- Jesus Christ in ACIM
In this episode, Dr. Marianne Miller explores the reality that many people with lifelong eating disorders do not resonate with the traditional idea of full recovery. She explains why harm reduction can offer a compassionate and sustainable path for individuals who have lived with chronic anorexia, long term bulimia, binge eating disorder, ARFID, and other long standing eating disorders. This conversation centers trauma history, neurodivergence, sensory needs, oppression, and the intersectional barriers that prevent many people from reaching what treatment programs often define as full recovery. If you have lived with an eating disorder for decades, if you have experienced trauma or misdiagnosis, if you are neurodivergent, or if you live in a marginalized body that has faced medical discrimination, you may find this episode deeply validating. Harm reduction gives you realistic recovery goals that respect your lived experience, your nervous system, and your access needs. What You Will Learn in This Episode Dr. Marianne explains how harm reduction works in eating disorder recovery and how it differs from traditional recovery models. She shows how harm reduction supports safety, stabilization, and dignity for people who have navigated chronic eating disorders for most of their lives. You will learn why the nervous system sometimes cannot tolerate pressure toward full recovery and why a flexible, collaborative approach can feel more aligned for many people. You will hear how sensory issues, interoception challenges, executive functioning differences, autistic burnout, and ADHD related overwhelm shape eating patterns for neurodivergent individuals. You will learn how trauma history, attachment ruptures, racialized stress, gender based discrimination, medical fatphobia, and identity marginalization influence both the development of eating disorders and the recovery process. Key Topics Covered This episode covers a wide range of topics that matter deeply for people with chronic eating disorders. These topics include how harm reduction supports stabilization when the long term eating disorder has become intertwined with survival. You will hear why the phrase full recovery can feel unrealistic or even harmful for people who have lived with their eating disorder for decades. Dr. Marianne explains how harm reduction creates safety, reduces shame, increases autonomy, and supports people who need a gentler and more individualized approach. The episode explores the role of neurodiversity in eating disorder recovery. This includes how sensory sensitivities shape food choices, how interoception differences impact hunger awareness, how executive functioning challenges influence meal consistency, and why many autistic and ADHD individuals need accessible, predictable, and customized strategies. You will also learn how intersectional oppression shapes health outcomes for people of color, queer and trans individuals, disabled individuals, fat individuals, and anyone living across multiple marginalized identities. Dr. Marianne describes what harm reduction can look like in daily life, from maintaining safe foods to creating sensory friendly meals to reducing medical instability in small, sustainable steps. She shares how this approach honors personal history and current capacity and how it helps many people live with more stability and less suffering. Who This Episode Is For This episode is for anyone living with a lifelong eating disorder who has felt pressure to pursue full recovery even when that expectation does not align with their reality. It is for people with chronic anorexia, chronic bulimia, long term binge eating disorder, ARFID shaped by sensory needs, and individuals with complex trauma who feel overwhelmed by traditional treatment expectations. This episode is also for neurodivergent individuals who live with autistic sensory profiles, ADHD impulsivity, interoception challenges, and executive functioning struggles that interfere with eating. It is for people living in marginalized bodies who have experienced medical discrimination or misdiagnosis. It is for professionals who want to learn how to apply harm reduction to eating disorder treatment in inclusive, neurodivergent affirming, and identity informed ways. Why This Episode Matters Many people with chronic or lifelong eating disorders feel invisible in mainstream recovery culture. They hear messages that full recovery is the only worthy goal and feel ashamed when their body or nervous system cannot meet those expectations. This episode names that truth with compassion. Harm reduction is a valid and ethical approach that honors lived experience and brings relief to people who need safety more than perfection. This episode matters because it acknowledges the role of trauma, neurodivergence, sensory needs, and intersectionality in long term eating disorders. It challenges the idea that recovery must look the same for everyone. It shows that you deserve care even if your healing does not follow a traditional blueprint. Your life still holds value and possibility. Related Episodes Orthorexia, Quasi-Recovery, & Lifelong Eating Disorder Struggles with Dr. Lara Zibarras @drlarazib on Apple & Spotify. Navigating a Long-Term Eating Disorder on Apple & Spotify. Why Eating Disorder Recovery Feels Unsafe: Facing Ambivalence in Long-Term Struggles on Apple & Spotify. Perfectionism, People-Pleasing, & Body Image: Self-Compassion Tools for Long-Term Eating Disorder Recovery With Carrie Pollard, MSW @compassionate_counsellor on Apple & Spotify. Resources and Support If you want more resources on lifelong eating disorders, harm reduction, ARFID, sensory based eating, and neurodivergent affirming care, visit drmariannemiller.com where you will find blog posts, guides, and links to specialized support. You can also explore my ARFID course and binge eating recovery membership options if you want deeper help with binge eating disorder, bulimia, ARFID, or long term eating disorder recovery. My work supports clients in California, Texas, Washington DC, and internationally through coaching. Join the Conversation If this episode resonated with your experience of a lifelong eating disorder or if you are curious about harm reduction as a recovery model, I would love to hear your thoughts. You can connect with me on Instagram at @drmariannemiller and share what stood out to you. For More Dr. Marianne-Land Podcast Episodes To explore more episodes on eating disorders, neurodiversity, trauma, and body liberation, listen to the full archive on your favorite podcast platform.
Business Wars: Follow Business Wars on the Wondery App or wherever you get your podcasts. True Classic: Upgrade your wardrobe at https://trueclassic.com/impact Linkedin: Post your job free at https://linkedin.com/impacttheory CashApp: Download Cash App Today: https://capl.onelink.me/vFut/v6nymgjl #CashAppPod HomeServe: Help protect your home systems – and your wallet – with HomeServe against covered repairs. Plans start at just $4.99 a month at https://homeserve.com Quince: Go to https://quince.com/IMPACTPOD for free shipping on your order and 365-day returns. Huel: 15% off with this exclusive offer for New Customers only with code impact at https://huel.com/impact (Minimum $75 purchase). Netsuite: Right now, get our free business guide, Demystifying AI, at https://NetSuite.com/Theory Raycon: Up to 20% off during this holiday season at https://buyraycon.com/IMPACTTHEORYBC ButcherBox: New users will receive their choice between filet mignon, ribeye or NY Strip in every box for a year + $20 off! at https://butcherbox.com/impact What's up, everybody? It's Tom Bilyeu here: If you want my help... STARTING a business: join me here at ZERO TO FOUNDER: https://tombilyeu.com/zero-to-founder?utm_campaign=Podcast%20Offer&utm_source=podca[%E2%80%A6]d%20end%20of%20show&utm_content=podcast%20ad%20end%20of%20show SCALING a business: see if you qualify here.: https://tombilyeu.com/call Get my battle-tested strategies and insights delivered weekly to your inbox: sign up here.: https://tombilyeu.com/ ********************************************************************** If you're serious about leveling up your life, I urge you to check out my new podcast, Tom Bilyeu's Mindset Playbook —a goldmine of my most impactful episodes on mindset, business, and health. Trust me, your future self will thank you. ********************************************************************** FOLLOW TOM: Instagram: https://www.instagram.com/tombilyeu/ Tik Tok: https://www.tiktok.com/@tombilyeu?lang=en Twitter: https://twitter.com/tombilyeu YouTube: https://www.youtube.com/@TomBilyeu Tom Bilyeu welcomes prolific Bitcoin philosopher and decentralization advocate Robert Breedlove for an electrifying conversation about money, power, and the future of civilization. Known for his rigorous critiques of central banking and his optimistic vision for personal sovereignty, Robert Breedlove brings decades of economic insight and philosophical inquiry to the table. Together, he and Tom Bilyeu break down the practical and ethical problems underlying today's political headlines, including the resurgence of socialism, the structure of the “deep state,” and why incentives drive the behavior of individuals and institutions. In Part 1, Tom and Robert explore the fundamental flaws of centralized systems—from socialist governance and political theater to the mechanics and consequences of central banking and inflation. The conversation examines the history of money itself, the unintended consequences of trying to organize society from the top down, and the anatomy of coercion versus consent in economics. Whether you're skeptical of government spending or on the hunt for financial security in turbulent times, this episode offers a lucid roadmap for understanding the motivations and incentives shaping our world. FOLLOW ROBERT BREEDLOVE:Twitter/X: https://twitter.com/Breedlove22Website: https://www.whatismoneypodcast.com Learn more about your ad choices. Visit megaphone.fm/adchoices
Today I'm talking with Jason Reid about one of the hardest parts of parenting: having real, honest conversations with our kids about the things nobody wants to bring up. The messy things. The scary things. The things we hope aren't happening—but often are. Jason shares his family's story of losing his 14-year-old son to suicide, and the gained wisdom he's sharing with all of us. He reveals the number one mistake we simply cannot afford to make as parents, and how small shifts in our conversations can genuinely protect our kids. This isn't an episode about fear—it's about clarity, courage, and the kind of connection that makes all the difference. We talk about how to support our kids through their struggles without pretending we have it all together, and how to keep it real with our own emotions in the process. If you're wanting practical, compassionate guidance for navigating hard conversations, strengthening trust, and being a safe place for your teen when life gets heavy, this episode will meet you right where you are. About my guest: Jason Reid is a partner at CEO International, where he coaches CEOs on how to be successful. He co-founded National Services Group, which employs 2500 people across three brands nationwide. He is a leader, entrepreneur, and family man. Following the loss of his 14-year-old son to suicide in 2018, Jason started the foundation TellMyStory.org, a nonprofit organization built to educate and empower parents by sharing the best and latest resources they need to identify and understand how to support their children's mental health struggles. Through its sister organization, Mental Wellness Media, it helps generate awareness through powerful media projects that compels parents and kids to better communicate and share their stories. Jason has shared his experience in two TEDx talks, the documentary films Tell My Story, What I Wish My Parents Knew and Tell My Story's other educational programs.
“What a GLP-1 agonist does is teach us about our weight health hormones.” - Ashley KoffGLP-1 medications are everywhere right now, and for many women in perimenopause, they feel like the only thing that can finally move the needle. But for practitioners, this landscape is far more nuanced. In midlife, women's weight is tied to shifting sex hormones, gut peptide function, nutrient status, nervous system load, inflammation, and life experiences. When GLP-1s enter the picture, they can help, they can harm, and they can reveal underlying issues we might otherwise miss.Understanding how these medications work inside the full weight ecosystem is an essential part of responsible, trauma-informed care. GLP-1s impact digestion, vagal tone, appetite signaling, bowel motility, and cardiometabolic markers, and they interact with stress physiology and immune activation in ways that can either support or destabilize clients already navigating complex chronic conditions. When practitioners rely on GLP-1s as a standalone tool, we risk overlooking the deeper patterns driving weight changes in perimenopause.Today, I'm joined by registered dietitian Ashley Koff, author of Your Best Shot, for an evidence-informed conversation about GLP-1s in midlife. Together, we explore when these medications can support whole-body health, when they create new problems, how to evaluate your clients' readiness, red flags that practitioners often miss, assessments to determine whether your clients' weight health hormones are functioning as intended, low and microdosing strategies, how GLP-1s influence pain and immune activation, why a multidisciplinary approach is essential for sustainable outcomes, and more.Enjoy the episode, and let's innovate and integrate together!---Learn more or watch the video version of this conversation at https://integrativewomenshealthinstitute.com/ashley-koff-on-glp-1s-and-weight-in-perimenopause-when-they-help-when-they-harm-and-the-red-flags-youre-missing/.Connect with me and access our entire platform at IntegrativeWomensHealthInstitute.com (https://integrativewomenshealthinstitute.com/). Find and follow us @integrativewomenshealth on YouTube (https://www.youtube.com/@integrativewomenshealth) and Instagram (https://www.instagram.com/integrativewomenshealth/).
The Financial Therapy Podcast - It's Not Just About The Money
When faith dictates money, the fallout can be devastating—especially for women. In this conversation with Sarah Carr, the focus turns to how rigid gender roles, abuse, and teachings like “God will provide” leave families financially vulnerable and women without autonomy. They explore how inherited beliefs around worthiness, guilt, and divine blessing shape earning potential, retirement savings, and even the courage to ask for a raise. From global inheritance laws to childhood prayers about the end of the world, the discussion shows how spiritual conditioning can sabotage financial security—and how awareness is the first step toward freedom. #WomenAndMoney #FinancialEmpowerment #MoneyAndFaith #GenderAndFinance #FinancialIndependence #MoneyMindset #FinancialFreedom #MoneyHealing #InheritedMoneyBeliefs #SpiritualConditioning #FinancialWellness #MoneyAwareness #WomenAndWealth #FinancialAutonomy #BreakingMoneyPatterns A podcast that blends the nuts and bolts of financial advice with the emotions that drive our money decisions. Join Rick Kahler, CFP®, CFT™, as he blends practical financial wisdom with the emotional insights that shape our choices. Discover how financial therapy can help you make money decisions that truly align with your values..
Today's show tackles the uncomfortable truth: not every "spiritual helper" is on your side. We break down a series of short but potent dreams—canaries, scrambled eggs, a gorgeous man with an ugly mouth, contact-papered windows, a locker-room monster, plastic "foghorns," an airplane intercom—and show how they warn about masked influence, scrambled gifts, and hidden energetic connections. Then we pivot to two follow-up dreams ("Trevor Loses His Wand" and "I'm Always Precise on Timing") that model exactly how to detect, remove, and re-check those connections. You'll learn: • How dreams flag scrambled gifts (canary + scrambled eggs) and masked guides (beauty with a "bad mouth"). • Why "contact paper" across windows signals blocked visibility into your field. • How an autistic boy in a dream (and waking life) validates perception of evil ("Perceval" pun) and confirms the warning. • What the locker-room creature reveals about who's really behind the mask. • The case for foghorns and airplane intercoms—when your dreams say "you must warn others." • A practical connection sweep: checking for incoming/outgoing links (especially from chakras) and clearing the outgoing ones you own. • Why not to "clear" others unless it's your lane—and how to build your own defense routines. Want the truth? Check your dreams. They show what's really happening—and who's doing it. ⸻ Chapters • 00:00 Smiles can be deceiving: the opener & why dreams tell the truth • 00:23 Welcome & setup • 01:16 Canary + scrambled eggs: "scrambled gifts" warning • 03:11 The gorgeous man with the ugly mouth: spotting a mask • 06:03 "Perceval" (perceived evil): autistic radar & the real tell • 08:01 Contact paper over windows: hiding the work • 09:02 Locker-room creature: what's behind the glamour • 12:09 Plastic plants → foghorns: when your dream says "warn people" • 12:40 Airplane intercom: you're handed the mic—use it • 13:26 Waking-life sync: autistic boy flags the same source • 15:13 Lightworkers get duped—how it becomes a lesson • 16:43 Building your "defense against the dark arts" toolkit • 18:58 Don't clear others unless it's your gift • 19:43 "Trevor Loses His Wand": connection created → severed • 22:00 How to run a connection sweep (incoming/outgoing; chakras) • 24:10 "I'm Always Precise on Timing": airport connections & "voodoo" clue • 25:38 Takeaways: trust the dream, follow its instructions • 26:16 Outro & quick reminder to audit your connections regularly
A new 47-page Senate Commerce Committee staff report titled “Flight Risk” alleges that the Biden administration asked federal transportation agencies to identify airport facilities that could be used to temporarily house or process migrants.The report references verified cases at Boston Logan, Chicago O'Hare, and JFK Airport, including housing totals, recorded incidents, and cost figures such as the $779,000 expenditure at Boston Logan.In today's breakdown, we walk through:– What the report says– The verified airport impacts– Internal communications referenced by the Senate– The documented JFK security breach– The known costs to taxpayers– What Congress may do nextThis video presents the findings in a clear, fact-driven format, using only publicly verified information.☑️ GET FREE RESEARCH NOTES HERE: https://professornez.kit.com/flightriskreport▶Sign up to our Free Newsletter, so you never miss out: https://bio.site/professornez▶Support the Channel and Buy us a Coffee: https://buymeacoffee.com/professornez☑️JOIN US and Become a MEMBER of NEZNATION: https://www.youtube.com/channel/UC4vxhI2-CpDPt16TCUF0Tmw/join#FlightRiskReport #SenateReport #AirportSecurity #AviationNews #CurrentEvents
A study of more than 1.3 million Americans found that people living in areas with high trichloroethylene (TCE) levels had a 10% greater risk of Parkinson's disease than those in cleaner regions TCE, a solvent once used in dry cleaning and degreasing, persists in air, soil, and groundwater for decades, exposing people through contaminated water and indoor air — even far from industrial sites Laboratory research revealed that TCE damages dopamine-producing neurons, disrupts mitochondrial energy production, and causes toxic protein buildup like that seen in Parkinson's patients The studies show that chronic, low-level exposure to environmental toxins silently erodes brain health over time, especially in older adults with weakened cellular repair systems Reducing exposure through clean water, good ventilation, and low-toxin household choices — while supporting your cells through restorative sleep, regular movement, and whole, unprocessed foods — helps protect mitochondrial energy production and strengthen long-term neurological resilience
Effective altruism is a philosophical and social movement that uses empirical data to maximize the impact of charitable efforts. Those who champion EA praise its methodological framework for maximizing the effectiveness of donations, thus ensuring equal consideration for all individuals. Those who challenge EA argue that its emphasis on measurable outcomes may overlook important yet hard-to-quantify causes, potentially restricting the scope of what's considered beneficial. Now we debate: Does the Effective Altruism Movement Get Giving Right? Arguing Yes: Peter Singer, Author of “The Most Good You Can Do”; Philosopher and Emeritus Professor of Bioethics at the University Center for Human Values at Princeton University Arguing No: Alice Crary, Co-Editor of “The Good it Promises, The Harm it Does: Critical Essays on Effective Altruism”; University Distinguished Professor of Philosophy at The New School for Social Research Emmy award-winning journalist John Donvan moderates Visit our Substack to watch more insightful debates and subscribe to our newsletter. Learn more about your ad choices. Visit podcastchoices.com/adchoices
The menopause transition is a critical tipping point for bone health. Bone loss accelerates rapidly in late perimenopause and continues for roughly 3 to 5 years after menopause begins–a window in which some women lose up to 20% of their total bone mass. For too long, society accepted this decline as inevitable. That fragility is our fate. That as women, our stature–and our lives and our worlds–just shrink as we age. Dr. Lisa Moore, DPT, founder of Brick House Bones, is on a mission to change that. After a surprise osteopenia diagnosis of her own, she rebuilt her bone density by 3% in a single year. Now she's helping tens of thousands of women reclaim their skeletal strength, too, including those navigating uniquely challenging circumstances like cancer recovery. She shares her recipe for maintaining and building strong bones this week.Dr. Lisa Moore, DPT, is on a mission to help over one million people with low bone density turn fear into action—and build the strength to do the things they love with the people they love! She's a Doctor of Physical Therapy, a certified yoga and mindfulness educator, and a BoneFit™ Trained Healthcare Professional specializing in evidence-based exercise for osteoporosis. Lisa is the founder of Brick House Bones, a global movement helping women build stronger bodies and stronger bones. She also runs her own clinic, Strong Bones Physical Therapy, just outside of Seattle, Washington. With degrees from the University of Maine, the University of Washington, and the University of South Dakota, Lisa brings together science, movement, compassion, and community to help her clients thrive at every age.ResourcesBrick House Bones with Dr. Lisa Moore, DPT, hereHigh-Intensity Resistance and Impact Training Improves Bone Mineral Density and Physical Function in Postmenopausal Women With Osteopenia and Osteoporosis: The LIFTMOR Randomized Controlled Trial, hereStronger back muscles reduce the incidence of vertebral fractures: a prospective 10 year follow-up of postmenopausal women, hereSkeletal site-specific effects of jump training on bone mineral density in adults: a systematic review and meta-analysis, hereWeighted Vests in Midlife: Hype? Help? Harm?, hereFRAX fracture risk calculator Sign up for our FREE Feisty 40+ newsletter: https://feisty.co/feisty-40/Learn More and Register for our 2026 Tucson Bike Camp: https://feisty.co/events/gravel-camp-x-bike-mechanic-school/ Follow Us on Instagram:Feisty Menopause: @feistymenopause Hit Play Not Pause Facebook Group: https://www.facebook.com/groups/807943973376099 Support our Partners:Cozy Earth: Use Code HITPLAY at https://cozyearth.com/ Midi Health: You Deserve to Feel Great. Book your virtual visit today at https://www.joinmidi.com/Nutrisense: Go to nutrisense.io/hitplay and use code: HITPLAY to get 30% offPrevinex: Get 15% off your first order with code HITPLAY at https://www.previnex.com/ Wahoo KICKR RUN: Use the code FEISTY to get a free Headwind Smart Fan (value $300) with the purchase of a Wahoo KICKR RUN at https://shorturl.at/maTzL
In episode 513 I chat with Amanda who has kindly agreed to share her OCD story with us. We discuss OCD themes of religion, harm and contamination. Amanda talks about depression, controlling food, stopping driving, navigating the Covid pandemic and OCD, compulsions controlling other people, therapy, grief and loss, figuring out it was ok not to do her compulsions, exposure and response prevention therapy (ERP), inference-based CBT (I-CBT), medication, managing family accommodation, words of hope and much more. Hope it helps. Show notes: https://theocdstories.com/episode/amanda-513 The podcast is made possible by NOCD. NOCD offers effective, convenient therapy available in the US and outside the US. To find out more about NOCD, their therapy plans and if they currently take your insurance head over to https://go.treatmyocd.com/theocdstories Join many other listeners getting our weekly emails. Never miss a podcast episode or update: https://theocdstories.com/newsletter
See omnystudio.com/listener for privacy information.
Is homeopathy a gentle natural cure… or just really confident sugar pills? This week on Hysteria 51 Kevin Crispin of the Behind Beautiful Things podcast joins us as we dive into the strange world of “like cures like,” ultra-dilutions, and remedies so watered down they make LaCroix look concentrated. From onion pills for allergies to ghostly duck-liver flu treatments, we break down how homeopathy works, why people swear by it, and how it can turn downright dangerous when it replaces real medical care.We'll explore the bizarre history of homeopathy, its modern comeback as “alternative medicine,” and the very real harm when serious conditions get treated with nothing more than placebo pellets and good vibes. But we're also turning a skeptical eye on the U.S. healthcare system itself—because when seeing a real doctor costs a small mortgage payment, it's no wonder people reach for magic water. Tune in for jokes, science, and just enough rage to dilute your faith in everyone equally.Special thanks to this week's research sources:WebsitesArizona Homeopathic - https://arizonahomeopathic.org/homeopathy-and-covid-19/ Discover Homeopathy - https://www.discoverhomeopathy.co.uk/victims/ Science Based Medicine - https://sciencebasedmedicine.org/belief-in-homeopathy-results-in-the-death-of-a-7-year-old-italian-child/ Springer - https://link.springer.com/article/10.1007/s00508-020-01624-x Scientific American - https://www.scientificamerican.com/article/hundreds-of-babies-harmed-by-homeopathic-remedies-families-say/ Perth Now - https://www.perthnow.com.au/news/cancer-victim-penelope-dingle-in-awe-of-homeopath---husband-ng-7c51c3e2f263eb5e4e530d5cb0a8b152 National Library of Medicine - https://pmc.ncbi.nlm.nih.gov/articles/PMC7253376/ National Library of Medicine - https://pmc.ncbi.nlm.nih.gov/articles/PMC1676328/Email us your favorite WEIRD news stories:weird@hysteria51.com Support the ShowGet exclusive content & perks as well as an ad and sponsor free experienceat https://www.patreon.com/Hysteria51 from just $1 ShopBe the Best Dressed at your Cult Meeting!https://www.teepublic.com/stores/hysteria51?ref_id=9022See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.
WarRoom Battleground EP 892: The Crisis In The Catholic Church And The Harm Of Uncontrolled Colonial-Era-Inspired Legal Migration
© 2020-2025 Ivy Podcast Discovery LLC
