POPULARITY
Categories
72 episodes with Harm
31 episodes with Harm
24 episodes with Harm
14 episodes with Harm
10 episodes with Harm
22 episodes with Harm
13 episodes with Harm
11 episodes with Harm
27 episodes with Harm
8 episodes with Harm
11 episodes with Harm
12 episodes with Harm
14 episodes with Harm
8 episodes with Harm
13 episodes with Harm
12 episodes with Harm
7 episodes with Harm
7 episodes with Harm
6 episodes with Harm
7 episodes with Harm
8 episodes with Harm
7 episodes with Harm
11 episodes with Harm
27 episodes with Harm
6 episodes with Harm
6 episodes with Harm
4 episodes with Harm
6 episodes with Harm
12 episodes with Harm
8 episodes with Harm
15 episodes with Harm
9 episodes with Harm
5 episodes with Harm
13 episodes with Harm
10 episodes with Harm
17 episodes with Harm
7 episodes with Harm
6 episodes with Harm
4 episodes with Harm
4 episodes with Harm
8 episodes with Harm
5 episodes with Harm
5 episodes with Harm
13 episodes with Harm
8 episodes with Harm
8 episodes with Harm
9 episodes with Harm
4 episodes with Harm
11 episodes with Harm
8 episodes with Harm
9 episodes with Harm
3 episodes with Harm
6 episodes with Harm
6 episodes with Harm
6 episodes with Harm
3 episodes with Harm
7 episodes with Harm
9 episodes with Harm
5 episodes with Harm
4 episodes with Harm
11 episodes with Harm
4 episodes with Harm
5 episodes with Harm
3 episodes with Harm
6 episodes with Harm
16 episodes with Harm
7 episodes with Harm
5 episodes with Harm
6 episodes with Harm
3 episodes with Harm
3 episodes with Harm
3 episodes with Harm
3 episodes with Harm
6 episodes with Harm
6 episodes with Harm
6 episodes with Harm
7 episodes with Harm
5 episodes with Harm
4 episodes with Harm
4 episodes with Harm
5 episodes with Harm
4 episodes with Harm
9 episodes with Harm
5 episodes with Harm
4 episodes with Harm
5 episodes with Harm
5 episodes with Harm
5 episodes with Harm
3 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
5 episodes with Harm
7 episodes with Harm
3 episodes with Harm
6 episodes with Harm
2 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
5 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
4 episodes with Harm
9 episodes with Harm
3 episodes with Harm
4 episodes with Harm
5 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
3 episodes with Harm
7 episodes with Harm
5 episodes with Harm
3 episodes with Harm
2 episodes with Harm
7 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
8 episodes with Harm
2 episodes with Harm
4 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
4 episodes with Harm
3 episodes with Harm
8 episodes with Harm
5 episodes with Harm
3 episodes with Harm
3 episodes with Harm
8 episodes with Harm
3 episodes with Harm
4 episodes with Harm
2 episodes with Harm
3 episodes with Harm
2 episodes with Harm
4 episodes with Harm
7 episodes with Harm
3 episodes with Harm
3 episodes with Harm
2 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
4 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
5 episodes with Harm
3 episodes with Harm
Priscilla Ward joins Dr. Sandie Morgan as they explore how true healing happens not through fixing or rescuing, but by learning to sit in discomfort, lead with curiosity, and create consistent communities where survivors can feel safe enough to begin their journey at their own pace. https://youtube.com/shorts/Jsi6YO3zobw?feature=share Priscilla Ward Priscilla Ward, LCSW, is the Founder and Clinical Director of Compass Rose Psychotherapy in Fullerton, California. With over 18 years in the helping profession and 15 years of clinical experience, she has dedicated her career to supporting youth, young adults, and families through trauma, anxiety, substance use, and grief. A graduate of the University of Southern California with a Master's in Social Work, Priscilla brings extensive experience from nonprofit agencies, community mental health clinics, correctional facilities, and school-based programs. She has led mental health teams for the Orange County Department of Education, developing trauma-responsive programs and training professionals in high-stress environments. Her bilingual Spanish fluency and cultural responsiveness make her a trusted ally across diverse communities. Beyond direct practice, Priscilla serves as a consultant and trainer, equipping educators, faith leaders, law enforcement personnel, and mental health professionals with trauma-informed, harm reduction, and motivational interviewing frameworks. Key Points People heal in community and relationship, not in isolation, and this healing process is rarely linear—it's complex and messy, especially for those who have experienced trauma. The shift from "what's wrong with this person" to "what happened to this person" is foundational to trauma-informed care and creates space for dignity and compassion over judgment. Harm reduction is a philosophy grounded in meeting people where they are, honoring their dignity even when they aren't ready to stop certain behaviors, and recognizing that small steps matter because keeping people alive and safe creates opportunities for future healing. Faith communities can love people well by learning to sit in discomfort and resist the urge to fix or rescue, instead focusing on building belonging without requiring behavioral compliance as a prerequisite. Understanding the stages of change (pre-contemplation, contemplation, preparation, action, maintenance, and sometimes relapse) helps helpers meet survivors appropriately at each stage rather than imposing expectations they're not ready for. Secondary trauma and burnout are real costs of caring, and taking care of our own wellness is critically important because we need to be healthy people in the room to truly serve others without reinforcing harm. Trust is the bridge for change, and consistency creates safety that literally rewires the brain—centering connection over correction leads to systemic change in how we support survivors. Listening to voices of lived experience is essential; helpers should ask "what do you need" rather than assuming they know what survivors need. Resources Compass Rose Psychotherapy Transcript [00:00:00] Priscilla Ward: what harm reduction looks like in my community might be very different than yours, but the spirit of harm reduction can be applied. Anywhere and everywhere. [00:00:11] Delaney: You know that uncomfortable space where things aren't neat or solved, what if that's where the real healing starts? Today's conversation leans into that gray area. The space where our instinct to fix meets the deeper need to simply be present. [00:00:25] When we let go of control and step into curiosity, we make room for safety, dignity, and real connection. That kind of community can change everything. Hi, I'm Delaney Menninger. I'm a student here at Vanguard University and I help produce this show. Today, Sandy talks with Priscilla Ward, a licensed clinical social worker who trains faith leaders and community team...
In this episode, we talk with Harm Goris about Thomas Aquinas's views of free will and human agency.Harm's website: https://tilburguniversity.academia.edu/HarmGorisHarm's chapter on Aquinas can be found in the Routledge Companion to Free Will.Twitter: https://twitter.com/thefreewillshowInstagram: https://www.instagram.com/thefreewillshow/?hl=enFacebook: https://www.facebook.com/The-Free-Will-Show-105535031200408/
Bryan Kohberger—the man who pleaded guilty to the brutal murders of four University of Idaho students—is reportedly considering extreme measures behind bars.See omnystudio.com/listener for privacy information.
You can't let it go until you know what it is. For all who have suffered satanic abuse, targeting, stalking and those who have lost their lives, the ones who remained behind.
You can't let it go until you know what it is. For all who have suffered satanic abuse, targeting, stalking and those who have lost their lives, the ones who remained behind.
Du lytter til en gammel episode av Harm og Hegseth. Morten og Vegard spiller inn episode nummer 500! De blir overrasket i studio med ballonger og en litt spesiell kake. Alt fra Harm og Hegseth hører du eksklusivt hos Podme.
Thursday, December 4th, 2025Today, the Pentagon knew there were survivors of the September 2nd boat strike; Ghislaine Maxwell is going to file a habeas petition challenging her incarceration and she' s worried the release of the Epstein Files will be damaging to her cause; Nancy Mace is considering following Marjorie Taylor Greene's lead and resigning before the end of her term in the House; the Department of Defense Inspector General found that Hegseth's Signal chat put troops in harm's way; Democrats swung 13 points with every county moving left in the special election for Tennessee's 7th Congressional District; the government is inviting employees to voluntarily disclose their disabilities; the House Judiciary Republicans have refused Jack Smith's demand for public testimony and have issued a subpoena to hold questioning behind closed doors; Judge Beryl Howell has barred the Trump administration from making warrantless arrests of immigrants in DC unless they're deemed a flight risk; the Speaker of the Virginia State House said the legislature is considering a 10D 1R congressional map; and Allison delivers and your Good News. Dana is out and about.Thank You, WildGrainGet $30 off your first box + free Croissants in every box. Go to Wildgrain.com/DAILYBEANS to start your subscription.Thank You, CBDistilleryUse promo code DAILYBEANS at CBDistillery.com for 25% off your purchase. MAGA Can't Spin Out of War Crimes! | ALLISON GILL AND THE LEFT HOOK WITH WAJAHAT ALISubscribe to MSW Media's YouTube Channel - YouTubeStoriesPentagon knew boat attack left survivors but still launched a follow-on strike, AP sources say | AP NewsPentagon watchdog finds Hegseth risked the safety of U.S. forces with use of Signal | NPRRepublican Anger Erupts at Johnson as Party Frets About Future | The New York TimesFederal Judge Bars Some Warrantless Immigration Arrests in D.C. | The New York TimesGood TroubleIf immigrants could attend their hearing over zoom, they wouldn't be at risk by just following the law and attending their immigration hearing.Petition for virtual court hearings:Petition · Stop ICE kidnappings at courts — demand virtual court hearings now! - United States · Change.org→No Contract, No Coffee→AACN Dept. of Education Proposed Limitation of Student Loan Access for Nursing→Red, Wine and Blue active North Carolina Community Trouble Nation→Mutual Aid Relief Fund, Mutual Aid Hub, GiveDirectly.org/snap→Group Directory - The Visibility Brigade: Resistance is Possible→Vote Yes 836 - Oklahoma is gathering signatures→How to Organize a Bearing Witness Standout→Find Your Representative | house.gov, Contacting U.S. SenatorsJoin Dana and The Daily Beans and support on Giving TuesdayGiving Tuesday - Support the work of the Human Rights Campaign, the nation's largest LGBTQ+ civil rights organization - The Daily BeansFrom The Good News100 Organizations Supporting Trans People in All 50 States | Them.usNational LGBT Resource Guide for Queer And Transgender OrganizationsPetition · Stop ICE kidnappings at courts — demand virtual court hearings now! - United States · Change.orgMan Cave - Timothy Mooney Repertory Theatre→Please submit your own Good Trouble and/or Good News.Our Donation LinksNational Security Counselors - Donate, MSW Media, Blue Wave CA Victory Fund | ActBlue, WhistleblowerAid.org/beansFederal workers - email AG at fedoath@pm.me and let me know what you're going to do, or just vent. I'm always here to listen.Dr. Allison Gill - Substack, BlueSky , IG, Twitter, MSW Media - YouTubeDana Goldberg - The 2025 Out100, BlueSky, Twitter, IG, facebook, danagoldberg.comMore from MSW Media - Shows - MSW Media, Cleanup On Aisle 45 pod, The Breakdown | SubstackReminder - you can see the pod pics if you become a Patron. The good news pics are at the bottom of the show notes of each Patreon episode! That's just one of the perks of subscribing! patreon.com/muellershewrote Our Donation LinksNational Security Counselors - DonateMSW Media, Blue Wave California Victory Fund | ActBlueWhistleblowerAid.org/beansFederal workers - feel free to email AG at fedoath@pm.me and let me know what you're going to do, or just vent. I'm always here to listen. Find Upcoming Actions 50501 Movement, No Kings.org, Indivisible.orgDr. Allison Gill - Substack, BlueSky , TikTok, IG, TwitterDana Goldberg - BlueSky, Twitter, IG, facebook, danagoldberg.comCheck out more from MSW Media - Shows - MSW Media, Cleanup On Aisle 45 pod, The Breakdown | SubstackShare your Good News or Good TroubleMSW Good News and Good TroubleHave some good news; a confession; or a correction to share?Good News & Confessions - The Daily Beanshttps://www.dailybeanspod.com/confessional/ Listener Survey:http://survey.podtrac.com/start-survey.aspx?pubid=BffJOlI7qQcF&ver=shortFollow the Podcast on Apple:The Daily Beans on Apple PodcastsWant to support the show and get it ad-free and early?The Daily Beans | SupercastThe Daily Beans & Mueller, She Wrote | PatreonThe Daily Beans | Apple Podcasts Hosted by Simplecast, an AdsWizz company. See pcm.adswizz.com for information about our collection and use of personal data for advertising.
In this Clinician's Corner episode, Clarissa and Molly dive into what they lovingly (and accurately) call the "Hella-Days"—that stretch from early fall through New Year's where routines disappear, food is everywhere, emotions are high, and nervous systems are fried. Together, they unpack why this season is so activating for people with food addiction and nervous system sensitivity, and how to navigate it with values, boundaries, and a whole lot of self-compassion—whether you're surrounded by family or spending the holidays on your own. In This Episode Clarissa & Molly explore: Why the holidays can feel like the "Holiday Hunger Games" and "12 Days of Dysregulation" How the nervous system responds to the build-up from September to New Year's Using values as your North Star for holiday decisions Boundary tools and scripts for parties, family gatherings, and food pushers Why holiday food environments are an "engineered stressor" (hello, peppermint-everything marketing) Strategies for: Going to events without abandoning your recovery Deciding when not to go Coping with loneliness, isolation, and dark evenings Harm reduction during high-exposure events ("good, better, best" thinking) How to re-imagine your holiday story over time instead of chasing perfection Ideas for folks who love the holidays (Clarissmas) and folks who… don't (Molly
Protecting children from the harmful side of social media has been a years-long fight, but Congress may finally be taking action. Today we hear about one mother's determination to bring change in memory of her daughter. Meanwhile, experts will offer research assistance to state legislators next session. Then, they followed the rules set up by the federal government, but still face deportation. It's just one development in the immigration debate affecting thousands of people in Colorado. And, he's the only Colorado native to play in the Negro Baseball League. Now, a century later he finally gets his due.
Send the show a text message!In this episode of the Space Between Podcast, Renae Lipsmeyer invites Caroline Markel to co-host and share her powerful story of overcoming domestic violence and abuse. Caroline discusses her journey of healing, the role of Dave Matthews Band community in her recovery, and the importance of addressing the normalization of violence. The conversation touches on the challenges of reporting abuse, the lack of support from authorities, and the innovative resources available through Safe in Harm's Way. Show Notes:Caroline Markel is the CEO and Founder of Safe In Harm's Way, a Kansas City-based nonprofit and an online secure resource for people navigating the sadness, worries, lies, screaming, fear, and pain of domestic violence. Premiering in Times Square, and spreading across the country, Caroline and her team launched two unique campaigns for diversified communities related to domestic violence, achieving one billion impressions and opportunities for immediate and actionable help. As CEO and Founder of Epizon Strategy Solutions, Caroline and her team create tailor-made solutions for employers within diversity, equity, and inclusion criteria related to profit, safety, retention, reward, and recruitment.As a survivor of domestic violence, plus revival from a death experience, Caroline uses storytelling to evoke change and has been featured on Oprah, Forbes, PBS, NPR, Ms. Magazine, M+M Magazine, national and regional television, and podcasts as an initiator to disrupt complacency within the domestic violence arena and overcoming adversity.Links from Episode:Caroline Markel Email: caroline@safeinharmsway.orgResources/Support: www.safeinharmsway.orgSupport the showTo share your DMB fan journey, email Renae: renae@thespacebetweenpodcastDMB.com
For the latest Whisper in the Wings from Stage Whisper, we welcomed on the actor William Franke and the director Illana Stein to talk about two shows, The Endgame and Don't Harm the Animals. theses works are being presented as a benefit reading for New Perspectives Theatre Company. The powerful works and the powerful subject matter were incredible to talk about. So be sure you hit play and come out to support this wonderful organization and artists today!The Endgame and Don't Harm the Animals by Joanna PickeringA Benefit Reading for New Perspectives Theatre Company December 10th at 7pm@ New Perspective StudioTickets and more information are available at newperspectivestheatre.org And be sure to follow our guests to stay up to date on all their upcoming projects and productions: newperspectivestheatre.org @illananyc @williamfrankenycwilliamfranke.com
Learn more about your ad choices. Visit megaphone.fm/adchoices
LESSON 337My Sinlessness Protects Me From All Harm.My sinlessness ensures me perfect peace, eternal safety, everlasting love, freedom forever from all thought of loss; complete deliverance from suffering. And only happiness can be my state, for only happiness is given me. What must I do to know all this is mine? I must accept Atonement for myself, and nothing more. God has already done all things that need be done. And I must learn I need do nothing of myself, for I need but accept my Self, my sinlessness, created for me, now already mine, to feel God's Love protecting me from harm, to understand my Father loves His Son; to know I am the Son my Father loves.You Who created me in sinlessness are not mistaken about what I am. I was mistaken when I thought I sinned, but I accept Atonement for myself. Father, my dream is ended now. Amen.- Jesus Christ in ACIM
In this episode, Dr. Marianne Miller explores the reality that many people with lifelong eating disorders do not resonate with the traditional idea of full recovery. She explains why harm reduction can offer a compassionate and sustainable path for individuals who have lived with chronic anorexia, long term bulimia, binge eating disorder, ARFID, and other long standing eating disorders. This conversation centers trauma history, neurodivergence, sensory needs, oppression, and the intersectional barriers that prevent many people from reaching what treatment programs often define as full recovery. If you have lived with an eating disorder for decades, if you have experienced trauma or misdiagnosis, if you are neurodivergent, or if you live in a marginalized body that has faced medical discrimination, you may find this episode deeply validating. Harm reduction gives you realistic recovery goals that respect your lived experience, your nervous system, and your access needs. What You Will Learn in This Episode Dr. Marianne explains how harm reduction works in eating disorder recovery and how it differs from traditional recovery models. She shows how harm reduction supports safety, stabilization, and dignity for people who have navigated chronic eating disorders for most of their lives. You will learn why the nervous system sometimes cannot tolerate pressure toward full recovery and why a flexible, collaborative approach can feel more aligned for many people. You will hear how sensory issues, interoception challenges, executive functioning differences, autistic burnout, and ADHD related overwhelm shape eating patterns for neurodivergent individuals. You will learn how trauma history, attachment ruptures, racialized stress, gender based discrimination, medical fatphobia, and identity marginalization influence both the development of eating disorders and the recovery process. Key Topics Covered This episode covers a wide range of topics that matter deeply for people with chronic eating disorders. These topics include how harm reduction supports stabilization when the long term eating disorder has become intertwined with survival. You will hear why the phrase full recovery can feel unrealistic or even harmful for people who have lived with their eating disorder for decades. Dr. Marianne explains how harm reduction creates safety, reduces shame, increases autonomy, and supports people who need a gentler and more individualized approach. The episode explores the role of neurodiversity in eating disorder recovery. This includes how sensory sensitivities shape food choices, how interoception differences impact hunger awareness, how executive functioning challenges influence meal consistency, and why many autistic and ADHD individuals need accessible, predictable, and customized strategies. You will also learn how intersectional oppression shapes health outcomes for people of color, queer and trans individuals, disabled individuals, fat individuals, and anyone living across multiple marginalized identities. Dr. Marianne describes what harm reduction can look like in daily life, from maintaining safe foods to creating sensory friendly meals to reducing medical instability in small, sustainable steps. She shares how this approach honors personal history and current capacity and how it helps many people live with more stability and less suffering. Who This Episode Is For This episode is for anyone living with a lifelong eating disorder who has felt pressure to pursue full recovery even when that expectation does not align with their reality. It is for people with chronic anorexia, chronic bulimia, long term binge eating disorder, ARFID shaped by sensory needs, and individuals with complex trauma who feel overwhelmed by traditional treatment expectations. This episode is also for neurodivergent individuals who live with autistic sensory profiles, ADHD impulsivity, interoception challenges, and executive functioning struggles that interfere with eating. It is for people living in marginalized bodies who have experienced medical discrimination or misdiagnosis. It is for professionals who want to learn how to apply harm reduction to eating disorder treatment in inclusive, neurodivergent affirming, and identity informed ways. Why This Episode Matters Many people with chronic or lifelong eating disorders feel invisible in mainstream recovery culture. They hear messages that full recovery is the only worthy goal and feel ashamed when their body or nervous system cannot meet those expectations. This episode names that truth with compassion. Harm reduction is a valid and ethical approach that honors lived experience and brings relief to people who need safety more than perfection. This episode matters because it acknowledges the role of trauma, neurodivergence, sensory needs, and intersectionality in long term eating disorders. It challenges the idea that recovery must look the same for everyone. It shows that you deserve care even if your healing does not follow a traditional blueprint. Your life still holds value and possibility. Related Episodes Orthorexia, Quasi-Recovery, & Lifelong Eating Disorder Struggles with Dr. Lara Zibarras @drlarazib on Apple & Spotify. Navigating a Long-Term Eating Disorder on Apple & Spotify. Why Eating Disorder Recovery Feels Unsafe: Facing Ambivalence in Long-Term Struggles on Apple & Spotify. Perfectionism, People-Pleasing, & Body Image: Self-Compassion Tools for Long-Term Eating Disorder Recovery With Carrie Pollard, MSW @compassionate_counsellor on Apple & Spotify. Resources and Support If you want more resources on lifelong eating disorders, harm reduction, ARFID, sensory based eating, and neurodivergent affirming care, visit drmariannemiller.com where you will find blog posts, guides, and links to specialized support. You can also explore my ARFID course and binge eating recovery membership options if you want deeper help with binge eating disorder, bulimia, ARFID, or long term eating disorder recovery. My work supports clients in California, Texas, Washington DC, and internationally through coaching. Join the Conversation If this episode resonated with your experience of a lifelong eating disorder or if you are curious about harm reduction as a recovery model, I would love to hear your thoughts. You can connect with me on Instagram at @drmariannemiller and share what stood out to you. For More Dr. Marianne-Land Podcast Episodes To explore more episodes on eating disorders, neurodiversity, trauma, and body liberation, listen to the full archive on your favorite podcast platform.
Business Wars: Follow Business Wars on the Wondery App or wherever you get your podcasts. True Classic: Upgrade your wardrobe at https://trueclassic.com/impact Linkedin: Post your job free at https://linkedin.com/impacttheory CashApp: Download Cash App Today: https://capl.onelink.me/vFut/v6nymgjl #CashAppPod HomeServe: Help protect your home systems – and your wallet – with HomeServe against covered repairs. Plans start at just $4.99 a month at https://homeserve.com Quince: Go to https://quince.com/IMPACTPOD for free shipping on your order and 365-day returns. Huel: 15% off with this exclusive offer for New Customers only with code impact at https://huel.com/impact (Minimum $75 purchase). Netsuite: Right now, get our free business guide, Demystifying AI, at https://NetSuite.com/Theory Raycon: Up to 20% off during this holiday season at https://buyraycon.com/IMPACTTHEORYBC ButcherBox: New users will receive their choice between filet mignon, ribeye or NY Strip in every box for a year + $20 off! at https://butcherbox.com/impact What's up, everybody? It's Tom Bilyeu here: If you want my help... STARTING a business: join me here at ZERO TO FOUNDER: https://tombilyeu.com/zero-to-founder?utm_campaign=Podcast%20Offer&utm_source=podca[%E2%80%A6]d%20end%20of%20show&utm_content=podcast%20ad%20end%20of%20show SCALING a business: see if you qualify here.: https://tombilyeu.com/call Get my battle-tested strategies and insights delivered weekly to your inbox: sign up here.: https://tombilyeu.com/ ********************************************************************** If you're serious about leveling up your life, I urge you to check out my new podcast, Tom Bilyeu's Mindset Playbook —a goldmine of my most impactful episodes on mindset, business, and health. Trust me, your future self will thank you. ********************************************************************** FOLLOW TOM: Instagram: https://www.instagram.com/tombilyeu/ Tik Tok: https://www.tiktok.com/@tombilyeu?lang=en Twitter: https://twitter.com/tombilyeu YouTube: https://www.youtube.com/@TomBilyeu Tom Bilyeu welcomes prolific Bitcoin philosopher and decentralization advocate Robert Breedlove for an electrifying conversation about money, power, and the future of civilization. Known for his rigorous critiques of central banking and his optimistic vision for personal sovereignty, Robert Breedlove brings decades of economic insight and philosophical inquiry to the table. Together, he and Tom Bilyeu break down the practical and ethical problems underlying today's political headlines, including the resurgence of socialism, the structure of the “deep state,” and why incentives drive the behavior of individuals and institutions. In Part 1, Tom and Robert explore the fundamental flaws of centralized systems—from socialist governance and political theater to the mechanics and consequences of central banking and inflation. The conversation examines the history of money itself, the unintended consequences of trying to organize society from the top down, and the anatomy of coercion versus consent in economics. Whether you're skeptical of government spending or on the hunt for financial security in turbulent times, this episode offers a lucid roadmap for understanding the motivations and incentives shaping our world. FOLLOW ROBERT BREEDLOVE:Twitter/X: https://twitter.com/Breedlove22Website: https://www.whatismoneypodcast.com Learn more about your ad choices. Visit megaphone.fm/adchoices
Today I'm talking with Jason Reid about one of the hardest parts of parenting: having real, honest conversations with our kids about the things nobody wants to bring up. The messy things. The scary things. The things we hope aren't happening—but often are. Jason shares his family's story of losing his 14-year-old son to suicide, and the gained wisdom he's sharing with all of us. He reveals the number one mistake we simply cannot afford to make as parents, and how small shifts in our conversations can genuinely protect our kids. This isn't an episode about fear—it's about clarity, courage, and the kind of connection that makes all the difference. We talk about how to support our kids through their struggles without pretending we have it all together, and how to keep it real with our own emotions in the process. If you're wanting practical, compassionate guidance for navigating hard conversations, strengthening trust, and being a safe place for your teen when life gets heavy, this episode will meet you right where you are. About my guest: Jason Reid is a partner at CEO International, where he coaches CEOs on how to be successful. He co-founded National Services Group, which employs 2500 people across three brands nationwide. He is a leader, entrepreneur, and family man. Following the loss of his 14-year-old son to suicide in 2018, Jason started the foundation TellMyStory.org, a nonprofit organization built to educate and empower parents by sharing the best and latest resources they need to identify and understand how to support their children's mental health struggles. Through its sister organization, Mental Wellness Media, it helps generate awareness through powerful media projects that compels parents and kids to better communicate and share their stories. Jason has shared his experience in two TEDx talks, the documentary films Tell My Story, What I Wish My Parents Knew and Tell My Story's other educational programs.
“What a GLP-1 agonist does is teach us about our weight health hormones.” - Ashley KoffGLP-1 medications are everywhere right now, and for many women in perimenopause, they feel like the only thing that can finally move the needle. But for practitioners, this landscape is far more nuanced. In midlife, women's weight is tied to shifting sex hormones, gut peptide function, nutrient status, nervous system load, inflammation, and life experiences. When GLP-1s enter the picture, they can help, they can harm, and they can reveal underlying issues we might otherwise miss.Understanding how these medications work inside the full weight ecosystem is an essential part of responsible, trauma-informed care. GLP-1s impact digestion, vagal tone, appetite signaling, bowel motility, and cardiometabolic markers, and they interact with stress physiology and immune activation in ways that can either support or destabilize clients already navigating complex chronic conditions. When practitioners rely on GLP-1s as a standalone tool, we risk overlooking the deeper patterns driving weight changes in perimenopause.Today, I'm joined by registered dietitian Ashley Koff, author of Your Best Shot, for an evidence-informed conversation about GLP-1s in midlife. Together, we explore when these medications can support whole-body health, when they create new problems, how to evaluate your clients' readiness, red flags that practitioners often miss, assessments to determine whether your clients' weight health hormones are functioning as intended, low and microdosing strategies, how GLP-1s influence pain and immune activation, why a multidisciplinary approach is essential for sustainable outcomes, and more.Enjoy the episode, and let's innovate and integrate together!---Learn more or watch the video version of this conversation at https://integrativewomenshealthinstitute.com/ashley-koff-on-glp-1s-and-weight-in-perimenopause-when-they-help-when-they-harm-and-the-red-flags-youre-missing/.Connect with me and access our entire platform at IntegrativeWomensHealthInstitute.com (https://integrativewomenshealthinstitute.com/). Find and follow us @integrativewomenshealth on YouTube (https://www.youtube.com/@integrativewomenshealth) and Instagram (https://www.instagram.com/integrativewomenshealth/).
The Financial Therapy Podcast - It's Not Just About The Money
When faith dictates money, the fallout can be devastating—especially for women. In this conversation with Sarah Carr, the focus turns to how rigid gender roles, abuse, and teachings like “God will provide” leave families financially vulnerable and women without autonomy. They explore how inherited beliefs around worthiness, guilt, and divine blessing shape earning potential, retirement savings, and even the courage to ask for a raise. From global inheritance laws to childhood prayers about the end of the world, the discussion shows how spiritual conditioning can sabotage financial security—and how awareness is the first step toward freedom. #WomenAndMoney #FinancialEmpowerment #MoneyAndFaith #GenderAndFinance #FinancialIndependence #MoneyMindset #FinancialFreedom #MoneyHealing #InheritedMoneyBeliefs #SpiritualConditioning #FinancialWellness #MoneyAwareness #WomenAndWealth #FinancialAutonomy #BreakingMoneyPatterns A podcast that blends the nuts and bolts of financial advice with the emotions that drive our money decisions. Join Rick Kahler, CFP®, CFT™, as he blends practical financial wisdom with the emotional insights that shape our choices. Discover how financial therapy can help you make money decisions that truly align with your values..
New research indicates that nightclubs could be doing more to prevent sexual harm in their venues. In this edition of The Conversation Hour we talk through what sorts of of things venues could be doing to decrease the risk.Also in this edition, keeping pets safe in high density housing, just how much will the metro tunnel reshape the way we travel in the years ahead plus, we speak to a linguist why MUTT could catch on as a nickname for the tunnel.
OPINION: Is BBM's presidency out of harm's way? | Dec. 3, 2025Subscribe to The Manila Times Channel - https://tmt.ph/YTSubscribe Visit our website at https://www.manilatimes.net Follow us: Facebook - https://tmt.ph/facebook Instagram - https://tmt.ph/instagram Twitter - https://tmt.ph/twitter DailyMotion - https://tmt.ph/dailymotion Subscribe to our Digital Edition - https://tmt.ph/digital Check out our Podcasts: Spotify - https://tmt.ph/spotify Apple Podcasts - https://tmt.ph/applepodcasts Amazon Music - https://tmt.ph/amazonmusic Deezer: https://tmt.ph/deezer Stitcher: https://tmt.ph/stitcherTune In: https://tmt.ph/tunein#TheManilaTimes#KeepUpWithTheTimes Hosted on Acast. See acast.com/privacy for more information.
Some people secretly rejoice when others are hurting — but this season reminds us to choose compassion over “harm-joy.” In this timely message, we confront the hidden attitudes of the heart and learn how Christ calls us to support, uplift, and love one another, especially in moments of struggle.#HarmJoy #ChristmasReflections #CITAMChurchOnline #ChurchEveryday
Thanks to everyone who helped make last week's Dark Nation Radio #1 in the “Electro” category on HearThis with over 1200 spins! This week's show is ready for streaming and features new tracks from bands including CZARINA, Absurd Minds, A Spell Inside, KY, Stoneburner, Mortes, LuckyAndLove, The Sedona Effect, and DJ Worlock. I hope you enjoy it and that you'll support all the great bands showcased here. https://www.mixcloud.com/cypheractive/dj-cyphers-dark-nation-radio-30-november-2025/ DJ cypher's Dark Nation Radio Playlist 30 November 2025 CZARINA, “Dagger in the Heart” The Sedona Effect, “Freakshow” LuckyandLove, “Secret is Out” DJ Worlock, “Emotion Overload” Maduro, “Death Kiss (debased edit)” Ex-Hyena, “Vanishing Edge” Pitch Black Manor, “Nursery Grime” Sexsomnia, “Vapor” Heartworms, “Retributions of an Awful Life” Miseria Ultima, “Displayed for Punishment” Adult., “Fools (We Are...)” Stoneburner, “Hollow Heartless” KY, “I surrender” Mortes, “Trapped (No Way Out)” House of Harm, “Carousel” Red Lorry Yellow Lorry, “Strange Kind of Paradise” Intrusive Pinky, “Hoops on Fire” Navigator Project, “Dystopia” The Funeral March, “Stars at Night (Instrumental)” Vision Video, “Dead Gods” Encephalon, “Like the Real Thing” Vempire, “Pet Sematary” True Moon, “Voodoo” Pink Stiletto, “Amour Finale” Absurd Minds, “Confessional” Whispers in the Shadow, “Flights of Fancy” Peter Murphy, “The Artroom Wonder” Mari Kattman, “Take” Noemi Aurora, “Keep Your Tears to Watter Your Roots” Rohn-Lederman, “Steal the Light (Beborn Beton remix)” The Halo Trees, “Bringing Light to the Room (Electronic mix)” A Spell Inside, “One More Century” DJ CYPHER'S DARK NATION RADIO—25 years strong! **Live Sundays @ 9 PM Eastern US on Spirit of Resistance Radio sorradio.org **Recorded @ http://www.mixcloud.com/cypheractive **Downloadable @ http://www.hearthis.at/cypheractive **Questions and material for airplay consideration to darknationradio[at] gmail[dot]com **Facebook @ http://www.facebook.com/groups/darknationradio
A new 47-page Senate Commerce Committee staff report titled “Flight Risk” alleges that the Biden administration asked federal transportation agencies to identify airport facilities that could be used to temporarily house or process migrants.The report references verified cases at Boston Logan, Chicago O'Hare, and JFK Airport, including housing totals, recorded incidents, and cost figures such as the $779,000 expenditure at Boston Logan.In today's breakdown, we walk through:– What the report says– The verified airport impacts– Internal communications referenced by the Senate– The documented JFK security breach– The known costs to taxpayers– What Congress may do nextThis video presents the findings in a clear, fact-driven format, using only publicly verified information.☑️ GET FREE RESEARCH NOTES HERE: https://professornez.kit.com/flightriskreport▶Sign up to our Free Newsletter, so you never miss out: https://bio.site/professornez▶Support the Channel and Buy us a Coffee: https://buymeacoffee.com/professornez☑️JOIN US and Become a MEMBER of NEZNATION: https://www.youtube.com/channel/UC4vxhI2-CpDPt16TCUF0Tmw/join#FlightRiskReport #SenateReport #AirportSecurity #AviationNews #CurrentEvents
A study of more than 1.3 million Americans found that people living in areas with high trichloroethylene (TCE) levels had a 10% greater risk of Parkinson's disease than those in cleaner regions TCE, a solvent once used in dry cleaning and degreasing, persists in air, soil, and groundwater for decades, exposing people through contaminated water and indoor air — even far from industrial sites Laboratory research revealed that TCE damages dopamine-producing neurons, disrupts mitochondrial energy production, and causes toxic protein buildup like that seen in Parkinson's patients The studies show that chronic, low-level exposure to environmental toxins silently erodes brain health over time, especially in older adults with weakened cellular repair systems Reducing exposure through clean water, good ventilation, and low-toxin household choices — while supporting your cells through restorative sleep, regular movement, and whole, unprocessed foods — helps protect mitochondrial energy production and strengthen long-term neurological resilience
Today's slow drag is with "Lover's Walk" from "Trust," released in 1981. The songwriting is credited to Elvis Costello. . . . Show Notes: Appreciation written, produced, and narrated by Remedy Robinson, MA,MFA Instagram: https://www.instagram.com/slow_drag_remedy/ Bluesky Social: https://bsky.app/profile/slowdragwithremedy.com Email: slowdragwithremedy@gmail.com "Elvis Costello Wiki Resource, Podcasts" https://www.elviscostello.info/wiki/index.php?title=Podcasts Transcription: https://slowdragwithremedy.weebly.com Podcast music by https://www.fesliyanstudios.com Rate this Podcast: https://ratethispodcast.com/slowdrag Slow Drag with Remedy on Amazon Music: https://music.amazon.com/podcasts/1f521a34-2ed9-4bd4-a936-1ad107969046/slow-drag-with-remedy-an-elvis-costello-appreciation References: Elvis Costello Wiki Resource, "Lover's Walk" https://www.elviscostello.info/wiki/index.php?title=Lovers_Walk "Lover's Walk" https://www.youtube.com/watch?v=aNCIzaBliTY "Lover's Walk" Lyrics I won't walk with my head bowed Beyond caution where lovers walk Your love walks where three's a crowd Beyond caution where lovers walk Lovers walk, lovers scramble Beyond caution where lovers walk Lovers step, shuffle and gamble Beyond caution where lovers walk Lovers trip, lovers stumble Lovers dip, lovers fumble (is that the word?) Lovers lip where love has crumbled Beyond caution where lovers walk Lovers strut, lovers stroll, lovers leap Lovers late, lovers wait Making promises that they can't keep Lovers link up arm in arm Lovers slink up, lovers charm Lovers drink up and come to harm Beyond caution where lovers walk Love is gone and it's no one's fault Love has stopped here, lovers halt Lovers don't walk, lovers run Will you look what love has done Will you look what love has done Will you look what love has done Beyond caution where lovers walk Now love's limping on a lover's crutch Looking for a hand with a personal touch Beyond caution where lovers walk
Learn more about your ad choices. Visit megaphone.fm/adchoices
Effective altruism is a philosophical and social movement that uses empirical data to maximize the impact of charitable efforts. Those who champion EA praise its methodological framework for maximizing the effectiveness of donations, thus ensuring equal consideration for all individuals. Those who challenge EA argue that its emphasis on measurable outcomes may overlook important yet hard-to-quantify causes, potentially restricting the scope of what's considered beneficial. Now we debate: Does the Effective Altruism Movement Get Giving Right? Arguing Yes: Peter Singer, Author of “The Most Good You Can Do”; Philosopher and Emeritus Professor of Bioethics at the University Center for Human Values at Princeton University Arguing No: Alice Crary, Co-Editor of “The Good it Promises, The Harm it Does: Critical Essays on Effective Altruism”; University Distinguished Professor of Philosophy at The New School for Social Research Emmy award-winning journalist John Donvan moderates Visit our Substack to watch more insightful debates and subscribe to our newsletter. Learn more about your ad choices. Visit podcastchoices.com/adchoices
Du lytter til en gammel episode av Harm og Hegseth. Morten har oppdaget en ny.. nei, gammel true crime podcast. Og det får Vegard til å spekulerer i en true crime fra selveste Stokke. Så blir det litt god gammeldags diskusjon om babynavn. Produsert av Karianne Hinlo. Alt fra Harm og Hegseth hører du eksklusivt hos Podme.
If 87% of profits come from 5% of gamblers, the game isn't fair. It's engineered. In this episode of BHT Bytes, hosts Sharlee Dixon and Peter Fenger take a compelling look at the rapid rise of sports betting and how it's transforming our culture. Everywhere we turn, our phones, TVs, social feeds, even college campuses, gambling has become woven into the sports experience. But beneath the excitement and big-win promises lies a growing set of consequences that few are talking about. Sharlee and Peter trace how the 2018 repeal of PASPA opened the door to a multibillion-dollar industry powered by polished ads, real-time data, and instant-access betting apps. They discuss the psychological hooks, VIP tactics, and predatory strategies that keep people wagering, even when it's no longer fun. With addiction rates climbing, athletes facing new risks, and young people being pulled into betting earlier than ever, this episode asks an urgent question: What happens when an entire generation grows up seeing gambling as just part of the game? This is a grounded, eye-opening conversation about the line between entertainment and harm, and why recognizing the darker side of sports betting has never been more important.
Green Left's Alex Bainbridge spoke to Tom Sulston from Digital Rights Watch about the coming social media ban, why it harms young people, what the alternatives would be and other issues related to digital privacy. We acknowledge that this was produced on stolen Aboriginal land. We express solidarity with ongoing struggles for justice for First Nations people and pay our respects to Elders past and present. If you like our work, become a supporter: https://www.greenleft.org.au/support Support Green Left on Patreon: https://www.patreon.com/greenleft Green Left online: https://www.greenleft.org.au/ Facebook: https://www.facebook.com/greenleftaction Twitter: https://twitter.com/greenleftonline YouTube: https://www.youtube.com/greenleftonline TikTok: https://www.tiktok.com/@greenleftonline Instagram: https://www.instagram.com/greenleftonline/ Podbean: https://greenleftonline.podbean.com/ Telegram: https://t.me/greenleftonline Podcast also available on Spotify, Apple Podcasts, Antennapod, Itunes and PodcastAddict.
The menopause transition is a critical tipping point for bone health. Bone loss accelerates rapidly in late perimenopause and continues for roughly 3 to 5 years after menopause begins–a window in which some women lose up to 20% of their total bone mass. For too long, society accepted this decline as inevitable. That fragility is our fate. That as women, our stature–and our lives and our worlds–just shrink as we age. Dr. Lisa Moore, DPT, founder of Brick House Bones, is on a mission to change that. After a surprise osteopenia diagnosis of her own, she rebuilt her bone density by 3% in a single year. Now she's helping tens of thousands of women reclaim their skeletal strength, too, including those navigating uniquely challenging circumstances like cancer recovery. She shares her recipe for maintaining and building strong bones this week.Dr. Lisa Moore, DPT, is on a mission to help over one million people with low bone density turn fear into action—and build the strength to do the things they love with the people they love! She's a Doctor of Physical Therapy, a certified yoga and mindfulness educator, and a BoneFit™ Trained Healthcare Professional specializing in evidence-based exercise for osteoporosis. Lisa is the founder of Brick House Bones, a global movement helping women build stronger bodies and stronger bones. She also runs her own clinic, Strong Bones Physical Therapy, just outside of Seattle, Washington. With degrees from the University of Maine, the University of Washington, and the University of South Dakota, Lisa brings together science, movement, compassion, and community to help her clients thrive at every age.ResourcesBrick House Bones with Dr. Lisa Moore, DPT, hereHigh-Intensity Resistance and Impact Training Improves Bone Mineral Density and Physical Function in Postmenopausal Women With Osteopenia and Osteoporosis: The LIFTMOR Randomized Controlled Trial, hereStronger back muscles reduce the incidence of vertebral fractures: a prospective 10 year follow-up of postmenopausal women, hereSkeletal site-specific effects of jump training on bone mineral density in adults: a systematic review and meta-analysis, hereWeighted Vests in Midlife: Hype? Help? Harm?, hereFRAX fracture risk calculator Sign up for our FREE Feisty 40+ newsletter: https://feisty.co/feisty-40/Learn More and Register for our 2026 Tucson Bike Camp: https://feisty.co/events/gravel-camp-x-bike-mechanic-school/ Follow Us on Instagram:Feisty Menopause: @feistymenopause Hit Play Not Pause Facebook Group: https://www.facebook.com/groups/807943973376099 Support our Partners:Cozy Earth: Use Code HITPLAY at https://cozyearth.com/ Midi Health: You Deserve to Feel Great. Book your virtual visit today at https://www.joinmidi.com/Nutrisense: Go to nutrisense.io/hitplay and use code: HITPLAY to get 30% offPrevinex: Get 15% off your first order with code HITPLAY at https://www.previnex.com/ Wahoo KICKR RUN: Use the code FEISTY to get a free Headwind Smart Fan (value $300) with the purchase of a Wahoo KICKR RUN at https://shorturl.at/maTzL
Most providers still don't recognize ARFID when it's right in front of them. In this episode, Dr. Marianne Miller unpacks why Avoidant/Restrictive Food Intake Disorder remains so misunderstood—and how that misunderstanding harms children and adults who live with it. Dr. Marianne explains what ARFID really is, how it shows up across neurotypes, and why messages like “just try harder” damage safety, trust, and nervous system regulation. Through a neurodivergent-affirming lens, she explores how bias, pressure, and diet-culture thinking keep ARFID invisible and why it's time for providers to see the reality of this eating disorder. Why This Episode Matters For too long, ARFID has been dismissed as “picky eating.” This episode reframes ARFID as a real, body-based eating disorder rooted in sensory processing, fear, or trauma—not defiance or willpower. Dr. Marianne highlights the emotional and physiological impact of being told to “try harder,” and how that phrase erodes autonomy, increases shame, and dysregulates the body. When we understand ARFID as a nervous-system and safety-based challenge, our entire approach to care changes. Listening replaces forcing. Collaboration replaces control. Compassion replaces shame. Key Topics Covered What ARFID Really Is: Understanding sensory-based, fear-based, and low-interest eating patterns that have nothing to do with dieting or body image. Why Professionals Miss It: How traditional training and diet-culture frameworks erase ARFID from diagnosis and treatment. The Harm of “Try Harder” Messages: Exploring what happens when people are shamed or pressured to eat against their nervous system's limits. The Neurodivergent Lens: How autism, ADHD, and other forms of neurodivergence intersect with eating, safety, and sensory regulation. The Role of Bias: Why marginalized identities—fat, BIPOC, neurodivergent, or gender-diverse people—are more likely to be misunderstood or dismissed. What Support Looks Like: How neurodivergent-affirming, sensory-attuned, and autonomy-based care creates safety and possibility. Who This Episode Is For Therapists, dietitians, and physicians who want to understand ARFID beyond stereotypes. Parents who feel blamed or overwhelmed by their child's restricted eating. Adults who have lived with food fear or sensory eating struggles and never had language for it. Neurodivergent people who want their experiences around food to be seen, validated, and supported. Content Caution This episode includes discussion of eating behaviors, sensory distress, and medical dismissal related to ARFID. Please take care of yourself and listen in a way that feels safe for your body and nervous system. Related Episodes ARFID Explained: What It Feels Like, Why It's Misunderstood, & What Helps on Apple & Spotify. Why Sensory-Attuned Care Matters More Than Exposure in ARFID Treatment on Apple & Spotify. ARFID, PDA, and Autonomy: Why Pressure Makes Eating Harder on Apple & Spotify. Complexities of Treating ARFID: How a Neurodivergent-Affirming, Sensory-Attuned Approach Works on Apple & Spotify. Learn More and Get Support If you want to understand ARFID more deeply or build sensory-attuned support skills, check out Dr. Marianne's self-paced ARFID & Selective Eating Course. This training explores sensory processing, collaborative care, and trauma-informed strategies for clinicians, parents, and community members. Visit drmariannemiller.com/arfid to learn more.
Bat Therapy: Psychology of Batman and other Comic Superheroes
Journalist Jacob Ward joins us as we use Tony Stark and Ozymandias to explore the psychological dangers of when technology is created and distributed without limits. Bonus: stick around until the end to find out Jake's perspective on how journalists are portrayed in comics!Jacob Ward has a background in technology journalism and behavioral science with experiences that include 6 years as technology correspondent for NBC News and hosting "Hacking Your Mind" (NSF-funded PBS documentary series). He wrote the book "The Loop: How A.I is Creating a World without Choices and How to Fight Back” and hosts his weekly podcast, The Rip Current, about the invisible forces driving tech, money, and politics.https://www.jacobward.com/Psychology sources: Protecting Our Children Online and Examining the Harm of AI Chatbots
Hospital stays can be overwhelming, confusing, and at times unsafe—and most families don't know what to look for or how to speak up. In this episode, Dr. Julie Siemers, a nurse, educator, and patient safety expert with more than 40 years of experience, shares the real risks inside hospitals and the practical steps every patient and family member can take to stay safe. Her stories are powerful, her advice is clear, and her mission is to help families advocate with confidence before harm occurs.In This Episode, We Cover:*Why preventable medical harm is so common—and the true statistics Julie discovered while researching patient safety.*The number one hidden cause of hospital errors: communication breakdown.*What patients should do before entering a hospital, including how to research safety grades.*How to speak up respectfully when something doesn't seem right, even if you're afraid of being dismissed.*The most important questions to ask at nurse shift change.*How to properly prepare aging parents or vulnerable loved ones for a hospital stay.*What to do if you feel brushed off by medical staff and how to use the chain of command.*Real stories from Julie's career that reveal how harm happens—and how it can be prevented.*A look at Julie's book, her upcoming patient safety app, and her nonprofit work to educate families.To find out more about Julie and her work, visit https://drjuliesiemers.com/.To find the health grade of the hospitals in your area, visit hospitalsafetygrade.org#podcast #podcasting #podmatch #sharagoswick #lifestoriespodcast #lifestories #conversation #interview #healthcare #hospital #nursing #doctor #patientsafety #care #communication #peoplehelpingpeople Want to be a guest on Life Stories Podcast? Send Shara Goswick a message on PodMatch, here: https://www.podmatch.com/hostdetailpreview/1718977880777072342a16683
This Day in Legal History: Lee Harvey Oswald ShotOn November 24, 1963, two days after President John F. Kennedy's assassination, the nation watched in shock as Lee Harvey Oswald—the alleged assassin—was gunned down on live television. The shooter, Dallas nightclub owner Jack Ruby, entered the basement of the Dallas police headquarters and fatally shot Oswald as he was being transferred to the county jail. The killing unfolded in front of journalists, cameras, and law enforcement, searing itself into the American consciousness and further fueling public distrust in official accounts of the assassination.Though Ruby claimed his act was motivated by grief and a desire to spare Jacqueline Kennedy the ordeal of a trial, his actions raised immediate concerns about the adequacy of security in high-profile cases. Oswald's death eliminated any opportunity for a public trial, which would have offered a transparent legal accounting of the events in Dallas. Ruby was later convicted of murder, though his conviction was overturned on appeal before he died of cancer in 1967.The legal ramifications of Oswald's televised murder were broad and lasting. It led to reforms in detainee protection, prompted scrutiny over media access in sensitive law enforcement operations, and spotlighted the vulnerability of chain of custody and judicial process in emotionally charged cases. The event also highlighted the need for careful separation between law enforcement procedures and the media spectacle surrounding them. Ruby's case prompted legal scholars to revisit the balance between a defendant's right to a fair trial and the public's right to observe proceedings.This legal flashpoint helped set the stage for subsequent debates about pretrial publicity, venue changes, and judicial instructions to mitigate media influence on juries. It also foreshadowed a new era where courtroom access and high-profile criminal justice collided in an age of mass media.The U.S. Court of Appeals for the D.C. Circuit will hear arguments in a press freedom case between the Associated Press (AP) and President Donald Trump's administration. The case centers on whether the White House violated constitutional protections by restricting AP's access to presidential events after the agency refused to adopt Trump's preferred term “Gulf of America” instead of the long-recognized “Gulf of Mexico.”In April, a federal judge—appointed by Trump—granted a preliminary injunction in AP's favor, requiring the administration to restore the agency's full access. However, the appeals court later paused that ruling while it considers the government's challenge. The Trump administration argues that news organizations do not have a constitutional right to “special access” to areas like the Oval Office.AP's lawsuit, filed in February, claims the restrictions are retaliatory and violate the First and Fifth Amendments. The case has drawn attention for its potential implications beyond journalism, touching on the broader question of whether the government can punish speech that conflicts with its messaging. The administration has defended its actions as part of a general press policy rather than targeted retaliation.The conflict escalated after Trump signed an executive order to rename the Gulf, which AP chose not to adopt due to its editorial standards. The White House then limited the agency's access and removed AP and Reuters from the regular press pool. AP has framed the case as critical to preventing government coercion of the press.US appeals court to rule if Trump can ban AP from Oval Office | ReutersNewly unsealed court filings allege that Meta Platforms shut down internal research after discovering evidence that Facebook use caused measurable harm to users' mental health. In a 2020 internal study, dubbed “Project Mercury,” Meta partnered with Nielsen to examine the effects of Facebook deactivation. Users who left the platform for a week reported lower levels of depression, anxiety, loneliness, and social comparison—results the company allegedly found troubling enough to halt further study and dismiss as tainted by public bias.Despite internal acknowledgment that the findings were valid, Meta did not publish the results and later told Congress it could not quantify harm from its products. The lawsuit—filed by U.S. school districts against Meta, TikTok, Snapchat, and Google—claims the platforms concealed known risks from users, parents, and educators. Plaintiffs also allege that Meta's safety features were deliberately underdeveloped, and that high thresholds for user removal allowed exploitative behavior to persist unchecked.Among the more serious accusations: Meta allegedly deprioritized child safety concerns in favor of platform growth, suppressed internal safety testing, and allowed human trafficking accounts to remain active until repeated violations were flagged—up to 17 times. Plaintiffs say Meta and other companies also tried to buy favorable public positioning by sponsoring child advocacy groups, such as TikTok's internal brag about its influence over the National PTA.Meta has denied the allegations, calling them misleading and based on selective quotes. The company says it has robust teen safety measures and that accounts involved in trafficking are now removed upon first report. A hearing on the matter is scheduled for January in federal court.Meta buried ‘causal' evidence of social media harm, US court filings allege | ReutersThe Trump administration is moving forward with plans to dismantle the U.S. Department of Education and relocate its functions across six other federal agencies, including Labor and Health and Human Services. According to multiple sources familiar with the effort, senior officials and department directors have been required to sign non-disclosure agreements (NDAs), an uncommon move for a civilian agency without a national security mandate. These agreements are reportedly being used to limit information sharing as the reorganization proceeds behind closed doors.Education Secretary Linda McMahon announced the restructuring this week, framing it as a way to “end federal micromanagement” while still supporting education through other agencies. Some staff have already transitioned to new posts, and more are expected to relocate by January. However, specifics on the timeline and scope of the overhaul remain vague, even to congressional oversight committees and education advocates.Critics argue the administration is sidelining Congress and the public in what they call an opaque and potentially destabilizing shift. Senator Patty Murray called the effort “sabotage,” citing the lack of transparency and collaboration. Meanwhile, McMahon has reportedly met with lawmakers and urged Congress to formalize the changes through legislation, though no formal bill has yet been introduced.US Education Department requiring non-disclosure agreements in Trump reorganization, sources say | ReutersIn a deep-dive investigation, FOIAball uncovered how UCLA Athletics appears to have routed large sums of money intended for football player NIL (Name, Image, and Likeness) deals through a tax-exempt charity—Shelter 37, run by the co-founder of the school's official NIL collective, Bruins for Life. This maneuver may have allowed donors to receive tax deductions for contributions that ultimately compensated athletes, despite recent IRS rulings stating such collectives do not qualify for charitable status.Emails obtained through public records show that UCLA development staff actively coached donors to send checks to Shelter 37 while explicitly designating those funds for Bruins for Life, the school's NIL program. These emails often discussed timing, amounts, and communication with the charity's leadership to ensure the money was redirected as intended. In several cases, UCLA staff reassured donors that contributions through donor-advised funds (DAFs)—normally restricted from supporting private benefit—could be routed to Shelter 37 and still benefit athletes.After the IRS began denying charitable status to NIL collectives in 2023 due to private benefit concerns, most programs shifted to non-deductible donations. But UCLA's workaround relied on Shelter 37's 501(c)(3) status to continue offering donors deductions, despite Shelter 37's own filings showing the vast majority of its funds in 2024—$3.6 million of $4.8 million—were raised for UCLA football NIL purposes. By contrast, it spent only $200 on scholarships for at-risk youth, its purported mission.Legal experts, including yours truly, told FOIAball that this could constitute fraudulent behavior, noting that charities must exercise control over their funds and serve the public interest—not act as pass-throughs for private benefit. UCLA officials, when asked for comment, did not address the specifics. Meanwhile, Shelter 37's president denied improper coordination but acknowledged the charity paid players to appear at events, an arrangement experts say still violates nonprofit law if the real intent is athlete compensation.How UCLA used a friendly charity to get tax-free NIL money This is a public episode. If you'd like to discuss this with other subscribers or get access to bonus episodes, visit www.minimumcomp.com/subscribe
In episode 513 I chat with Amanda who has kindly agreed to share her OCD story with us. We discuss OCD themes of religion, harm and contamination. Amanda talks about depression, controlling food, stopping driving, navigating the Covid pandemic and OCD, compulsions controlling other people, therapy, grief and loss, figuring out it was ok not to do her compulsions, exposure and response prevention therapy (ERP), inference-based CBT (I-CBT), medication, managing family accommodation, words of hope and much more. Hope it helps. Show notes: https://theocdstories.com/episode/amanda-513 The podcast is made possible by NOCD. NOCD offers effective, convenient therapy available in the US and outside the US. To find out more about NOCD, their therapy plans and if they currently take your insurance head over to https://go.treatmyocd.com/theocdstories Join many other listeners getting our weekly emails. Never miss a podcast episode or update: https://theocdstories.com/newsletter
See omnystudio.com/listener for privacy information.
Is homeopathy a gentle natural cure… or just really confident sugar pills? This week on Hysteria 51 Kevin Crispin of the Behind Beautiful Things podcast joins us as we dive into the strange world of “like cures like,” ultra-dilutions, and remedies so watered down they make LaCroix look concentrated. From onion pills for allergies to ghostly duck-liver flu treatments, we break down how homeopathy works, why people swear by it, and how it can turn downright dangerous when it replaces real medical care.We'll explore the bizarre history of homeopathy, its modern comeback as “alternative medicine,” and the very real harm when serious conditions get treated with nothing more than placebo pellets and good vibes. But we're also turning a skeptical eye on the U.S. healthcare system itself—because when seeing a real doctor costs a small mortgage payment, it's no wonder people reach for magic water. Tune in for jokes, science, and just enough rage to dilute your faith in everyone equally.Special thanks to this week's research sources:WebsitesArizona Homeopathic - https://arizonahomeopathic.org/homeopathy-and-covid-19/ Discover Homeopathy - https://www.discoverhomeopathy.co.uk/victims/ Science Based Medicine - https://sciencebasedmedicine.org/belief-in-homeopathy-results-in-the-death-of-a-7-year-old-italian-child/ Springer - https://link.springer.com/article/10.1007/s00508-020-01624-x Scientific American - https://www.scientificamerican.com/article/hundreds-of-babies-harmed-by-homeopathic-remedies-families-say/ Perth Now - https://www.perthnow.com.au/news/cancer-victim-penelope-dingle-in-awe-of-homeopath---husband-ng-7c51c3e2f263eb5e4e530d5cb0a8b152 National Library of Medicine - https://pmc.ncbi.nlm.nih.gov/articles/PMC7253376/ National Library of Medicine - https://pmc.ncbi.nlm.nih.gov/articles/PMC1676328/Email us your favorite WEIRD news stories:weird@hysteria51.com Support the ShowGet exclusive content & perks as well as an ad and sponsor free experienceat https://www.patreon.com/Hysteria51 from just $1 ShopBe the Best Dressed at your Cult Meeting!https://www.teepublic.com/stores/hysteria51?ref_id=9022See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.
Episode 206: Street Medicine and Harm Reduction. Mohammed Wase (medical student) and Dr. Singh describe what it is like to provide health care on the streets. They share their personal experiences working in a street medicine team. They describe the practice of harm reduction and emphasize the importance of respecting autonomy and being adaptable in street medicine. Written by Mohamed Wase, MSIV, American University of the Caribbean. Editing by Hector Arreaza, MD. Hosted by Harnek Singh, MD.You are listening to Rio Bravo qWeek Podcast, your weekly dose of knowledge brought to you by the Rio Bravo Family Medicine Residency Program from Bakersfield, California, a UCLA-affiliated program sponsored by Clinica Sierra Vista, Let Us Be Your Healthcare Home. This podcast was created for educational purposes only. Visit your primary care provider for additional medical advice.Introduction Dr. Singh: Welcome to another episode of our podcast, my name is Dr. Harnek Singh, faculty in the Rio Bravo Family Medicine Residency Program. Today we have prepared a great episode about street medicine, a field that has grown a lot during the last decade and continues to grow now. We are joined by a guest who is passionate about this topic. Wase, please introduce yourself.Wase: Hello everyone, my name is Mohammed, many know me as Wasé, I am a 4th year medical student from the American University of the Caribbean. Today we're diving into a topic that sits at the intersection of medicine, compassion, and public health — Street Medicine and Harm Reduction. We're going to step outside with this episode, literally, away from the clinic and hospital, to explore more about what care looks like in the streets. Historic background: How did street medicine start?Wase: The roots of Street Medicine in the United States go back to Dr. Jim Withers in Pittsburgh in the 1990s, who literally began by dressing as a homeless person and providing care on the streets to build trust. His efforts have shaped street medicine to what it is today. It combines primary care, mental health, and social support. Dr. Singh: For family physicians, this model aligns perfectly with our holistic approach. We don't just treat diseases; we treat people in context — their environment, their challenges, their stories. What is the main population seen by a street medicine team?Wase: This patient population includes those struggling with homelessness, housing insecurity, food insecurity, substance use disorders; with patients being preoccupied on where they will sleep that night or when their next meal comes, they do not have the luxury of prioritizing their health. Street Medicine is a powerful outreach program to bring care to them in order to provide equitable care within our community. Dr. Singh: How is street medicine different than caring for patients in the clinic?Wase: Working on the street means we have to think differently about what healthcare looks like — and that's whereharm reductioncomes in.What is Harm Reduction?Wase: Harm reduction is a public health philosophy that focuses on reducing the negative consequences of high-risk behaviors, rather than demanding complete abstinence.Dr. Singh: Preventive care is the backbone of family medicine. For example, we keep up with the USPSTF guidelines and make sure our patients are up to date with their screenings. But what does that look like in the street medicine setting? Wase: In practice, that might mean:-needle exchange program: Offering clean syringes to prevent HIV transmission and removing used needles-distributing naloxone to prevent overdose deaths-offering fentanyl test-strips to prevent use of substances that are unknowingly laced with fentanylDr. Singh: Also:-providing condoms to prevent sexually transmitted infections-providing wound care to prevent further spread of infectionWase: Yes, the idea is: people are going to engage in risky behaviors whether or not we approve of it, so let's meet them with compassion, tools, and trust instead of judgment. Harm reduction also applies beyond substance use; think about safer sex education, or even diabetic foot care among people who can't refrigerate insulin or change shoes daily. It's all about meeting people where they areandkeeping them alive and engaged in care. Planning in Street Medicine: Wase: It takes careful disposition planning and aftercare for this population. Instead of the traditional outpatient setting where we can place referrals and expect our patients to follow through with them. On street medicine, for follow up visits it requires arranging transportation, finding a pharmacy close in proximity, educating and counseling on medication adherence and how to make it, and making sure they have some sort of shelter to get by. Dr. Singh: Let's describe a typical street med encounter.Wase: A typical Street Medicine encounter might look like this: a small team — usually a physician, nurse, social worker, and sometimes a peer advocate — goes out with backpacks of supplies. They might start with wound care, blood pressure checks, or even medication refills. But what's just as important is the relationship-building. Sometimes, the first visit isn't about medicine at all — it's about showing up consistently.Over time, that trust opens the door for conversations about addiction treatment, mental health, and preventive care. For example, in some California Street Medicine programs, teams are treating chronic conditions like hypertension, diabetes, and hepatitis C, right where patients live with the same evidence-based care we'd give in a clinic. One of my favorite quotes from Street Medicine teams is: “We're not bringing people to healthcare; we're bringing healthcare to people.”Challenges in Street Medicine:Wase: The populations that you will encounter include many people who will often downplay their own health concerns and prior diagnoses. Unfortunately, this is usually from countless months or years of feeling neglected by our healthcare system. Some may even express distrust in our healthcare system and healthcare providers. Patient will, at times, be apprehensive to receive care or trust you enough to tell their story. Dr. Singh: Interviewing patients is a critical aspect of providing equitable care on the streets. It is always important to offer support and medical care, even if the patient denies it, always reassure that your street medicine clinic will be around every week and ready for them when they would like to seek care. Wase: Respecting patient autonomy is an utmost concern as well. Another element of interviewing to consider is to invite new ideas and information; instead of lecturing patients about taking medications on time or telling them they need to stop doing drugs—simply asking a patient “would you like to know more about how we can help you stop using opioids?” respects their choice but can also spark new ideas for them to consider. Singh: Adaptability is another key component to exceling patient care in street medicine. Like, performing physical exams on park benches or in the back of a minivan. Always doing good with our care but also respecting their autonomy is crucial in building a trust that these patients once lost with our system. Wase: Each patient has their own timeline, but we as providers should always assure them that our door is always open for them when they are ready to seek care. Conclusion.Wase: So, to wrap up — Street Medicine and harm reduction remind us that healthcare isn't just about hospitals and clinics. It's about relationships, trust, and dignity.Every patient deserves care, no matter where they sleep at night.If you're a resident or student listening, I encourage you to seek out these experiences — volunteer with Street Medicine teams, learn from harm reduction workers, and let it shape how you practice medicine. Thank you for listening to this episode of the Rio Bravo qWeek podcast. I'm Mohammed — and I hope this conversation inspires you to meet patients where they are and walk with them on their journey to health.Dr. Singh: If you liked this episode, share it with a friend or a colleague. This is Dr. Singh, signing off.Even without trying, every night you go to bed a little wiser. Thanks for listening to Rio Bravo qWeek Podcast. We want to hear from you, send us an email at RioBravoqWeek@clinicasierravista.org, or visit our website riobravofmrp.org/qweek. See you next week! _____________________References:Doohan, N.C. “Street Medicine: Creating a ‘Classroom Without Walls' for People Experiencing Homelessness.” PMC – National Library of Medicine, 2019.Hawk, M., et al. “Harm Reduction Principles for Healthcare Settings.” Harm Reduction Journal, vol. 14, no. 1, 2017.Withers, J.S. “Bringing Health Professions Education to Patients on the Streets.” Journal of Ethics, AMA, vol. 23, no. 11, Nov. 2021.“Our Story.” Street Medicine Institute, 2025, www.streetmedicine.org/our-story.“Principles of Harm Reduction.” National Harm Reduction Coalition, 2024, https://harmreduction.org/about-us/principles-of-harm-reduction/.Salisbury-Afshar, Elizabeth, Bryan Gale, and Sarah Mossburg. “Harm Reduction Strategies to Improve Safety for People Who Use Substances.” PSNet, Agency for Healthcare Research & Quality, 30 Oct. 2024.Douglass, A.R. “Exploring the Harm Reduction Paradigm: The Role of Boards in Drug Policy and Practice.” PMC – National Library of Medicine, 2024.Theme song, Works All The Time by Dominik Schwarzer, YouTube ID: CUBDNERZU8HXUHBS, purchased from https://www.premiumbeat.com/.
Du lytter til en gammel episode av Harm og Hegseth. Morten har vært på filmpremiere på Svalbard, Vegard har så vidt kommet seg etter 17. mai, og tar diskusjonen om bunad og flagg helst i ettertid. Produsert av Karianne Hinlo. Alt fra Harm og Hegseth hører du eksklusivt hos Podme.
Several cities and counties are addressing street homelessness with a new approach, which experts say can clear encampments while protecting the health of people who are forced to move.Guests:Josh Barocas, Associate Professor, University of Colorado Anschutz School of MedicineMarc Dones, Policy Director, Benioff Homelessness and Housing Initiative, University of California San FranciscoRyan Levi, Managing Editor, TradeoffsMatt Mahan, Mayor, City of San JoseJazmine MapesPeter Radu, Neighborhood Services Manager, City of BerkeleyLearn more and read a full transcript on our website.Want more Tradeoffs? Sign up for our free weekly newsletter featuring the latest health policy research and news.Support this type of journalism today, with a gift. Hosted on Acast. See acast.com/privacy for more information.
The Future of Crime Solving is our new series where we talk to law enforcement officials who are working to introduce eSleuth AI to police departments around the country. As part of this inaugural episode in the series, we interviewed former ATF official Eric Harden about his experience in law enforcement and his views on gang violence. If you're a law enforcement official curious about eSleuth AI, email Scot at sthomasson@esleuth.ai or check out their website at: https://www.esleuth.ai/Order our book on Delphi here: https://bookshop.org/p/books/shadow-of-the-bridge-the-delphi-murders-and-the-dark-side-of-the-american-heartland-aine-cain/21866881?ean=9781639369232Or here: https://www.simonandschuster.com/books/Shadow-of-the-Bridge/Aine-Cain/9781639369232Or here: https://www.amazon.com/Shadow-Bridge-Murders-American-Heartland/dp/1639369236Join our Patreon here! https://www.patreon.com/c/murdersheetSupport The Murder Sheet by buying a t-shirt here: https://www.murdersheetshop.com/Check out more inclusive sizing and t-shirt and merchandising options here: https://themurdersheet.dashery.com/Send tips to murdersheet@gmail.com.The Murder Sheet is a production of Mystery Sheet LLC.See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.
Michael Schnackenberg discusses faith-based investing. We're “rooted in a Biblical world view,” he explains. “Investing is ownership…you have an ethical responsibility in regards to products and practices.” He shares ETFs from his firm, Eventide, for interested investors, including ESSC, ESUM, and ESLG. He discusses criteria for the stocks being included, and how they benchmark performance. ======== Schwab Network ========Empowering every investor and trader, every market day. Subscribe to the Market Minute newsletter - https://schwabnetwork.com/subscribeDownload the iOS app - https://apps.apple.com/us/app/schwab-network/id1460719185Download the Amazon Fire Tv App - https://www.amazon.com/TD-Ameritrade-Network/dp/B07KRD76C7Watch on Sling - https://watch.sling.com/1/asset/191928615bd8d47686f94682aefaa007/watchWatch on Vizio - https://www.vizio.com/en/watchfreeplus-exploreWatch on DistroTV - https://www.distro.tv/live/schwab-network/Follow us on X – https://twitter.com/schwabnetworkFollow us on Facebook – https://www.facebook.com/schwabnetworkFollow us on LinkedIn - https://www.linkedin.com/company/schwab-network/ About Schwab Network - https://schwabnetwork.com/about
Imran Ahmed is the founding CEO of the Center for Countering Digital Hate, a leading voice in the fight against online hate, disinformation, and manipulation. From viral conspiracy theories to the influence of AI, CCDH has been pushing for accountability from the biggest tech platforms since it began. If you only listen to one episode this season - make it this one. Listen now!
The 2026 MLB CBA could have a massive impact on this MLB offseason (especially for the Cubs). Bruce Levine (Cubs Reporter) joins us to discuss the potential impact and what we should expect to see from the Cubs front office this offseason.Get your own Setup Man Swag: https://bit.ly/setupmanobviousFREE Cubs Talk Facebook Group: / cubstalk Go to www.setupman.net and subscribe to our mailing list to become a part of Setup Man Nation so you never miss a show! We also do free giveaways for those who are on our list!Check us out on social media:Instagram: https://bit.ly/setupmaninstaTwitter: https://bit.ly/setupmantwitter
WarRoom Battleground EP 892: The Crisis In The Catholic Church And The Harm Of Uncontrolled Colonial-Era-Inspired Legal Migration
The Tenpenny Files – A CDC whistleblower's claims prompt us to revisit allegations of data suppression and institutional conflicts. They describe a struggle over trust, transparency, and the role of public health agencies. The discussion highlights concerns about scientific integrity and the need for independent oversight while urging parents to seek clear, evidence-based information and make informed decisions...
Bobisode! Dr Kirk and Bob answer patron emails. (Intro) November 14, 2025 This episode is sponsored by BetterHelp. Give online therapy a try at betterhelp.com/KIRK to get 10% off your first month.00:00 Exposure with social anxietyBecome a member: https://www.youtube.com/channel/UCOUZWV1DRtHtpP2H48S7iiw/joinBecome a patron: https://www.patreon.com/PsychologyInSeattleEmail: https://www.psychologyinseattle.com/contactWebsite: https://www.psychologyinseattle.comMerch: https://psychologyinseattle-shop.fourthwall.com/Instagram: https://www.instagram.com/psychologyinseattle/Facebook Official Page: https://www.facebook.com/PsychologyInSeattle/TikTok: https://www.tiktok.com/@kirk.hondaThe Psychology In Seattle Podcast ®Trigger Warning: This episode may include topics such as assault, trauma, and discrimination. If necessary, listeners are encouraged to refrain from listening and care for their safety and well-being.Disclaimer: The content provided is for educational, informational, and entertainment purposes only. Nothing here constitutes personal or professional consultation, therapy, diagnosis, or creates a counselor-client relationship. Topics discussed may generate differing points of view. If you participate (by being a guest, submitting a question, or commenting) you must do so with the knowledge that we cannot control reactions or responses from others, which may not agree with you or feel unfair. Your participation on this site is at your own risk, accepting full responsibility for any liability or harm that may result. Anything you write here may be used for discussion or endorsement of the podcast. Opinions and views expressed by the host and guest hosts are personal views. Although, we take precautions and fact check, they should not be considered facts and the opinions may change. Opinions posted by participants (such as comments) are not those of the hosts. Readers should not rely on any information found here and should perform due diligence before taking any action. For a more extensive description of factors for you to consider, please see www.psychologyinseattle.com
(WATCH THIS EPISODE ON YOUTUBE) The State of Connecticut charged Teresa Beatty $249 per day, every day, while she was in prison for a minor drug offense from 2000 to 2002—But she wouldn't discover this until 20 years later. When her mother died in 2020, the State of Connecticut filed a notice in probate court demanding approximately 35%—over $83,000—of Beatty's inheritance. And it was perfectly legal. In fact, at least 45 states in America force you to pay (literally) for the privilege of being imprisoned in a country with one of the highest incarceration rates in the world... This is Beatty v. Lamont (2022), State v. Richey (2019), and "Pay-To-Stay" laws. Links Captive Money Lab: "Pay-to-stay laws keep a person incarcerated long after their prison term ends." Pay To Stay June 2025 Report, Campaign Zero Research & Policy Brief: "This report takes an in-depth look at pay-to-stay fee policies and practices of charging adults and youths held in jails, prisons, and youth residential facilities for the costs of their incarceration, including medical fees and expenses for room & board." The "Damaged" State v. the "Willful" Nonpayer: Pay-to-Stay and the Social Construction of Damage, Harm, and Moral Responsibility in a Rent-Seeking Society (2022) (Russell Sage Foundation Journal of the Social Sciences) *** CLICK HERE to PREORDER Reb's book: The Book They Throw At You—A Sarcastic Lawyer's Guide* To The Unholy Chaos of Our Legal System, *God No, Not Actual Legal Advice *** Follow @RebuttalPod on Instagram and Twitter! Follow @Rebmasel on TikTok, Instagram, and Twitter! *** 0:00 - Intro 00:10 - CASES BEGIN 10:10 - What is "Pay-to-Stay"? 18:16 - States say it teaches WHAT?! 19:22 - DOES THIS EVEN HELP "TAXPAYERS"? 24:19 - SPOILER: For-profit prisons is a bad idea 28:51 - Who shoulders this burden? Black, Hispanic, the poor 33:46 - PRISONS: DELIBERATE POVERTY AND FORCED LABOR 37:41 - Incarcerated people are forced to work 42:18 - Unsafe work conditions 43:20 - The South = Highest rate in entire world 44:17 - THESE NUMBERS ARE INSANE. 45:00 - Prison Banking 46:45 - Recent accounts from incarcerated people from Oct 2025 49:48 - Captive Money Lab Research: THE IMPACTS OF PAY-TO-STAY LAWS!!! 52:13 - Reb's Rebuttal Learn more about your ad choices. Visit megaphone.fm/adchoices
This is The Briefing, a daily analysis of news and events from a Christian worldview.On today's edition of The Briefing, Dr. Mohler discusses SCOTUS's declination to take case that could have led to overturning of Obergefell, SCOTUS's allowance of Trump's transgender passport policy, and the 16 states suing the Trump administration over ‘morality of harm.'Part I (00:14 – 06:10)Supreme Court Declines to Take Case That Could Have Led to the Overturning of Obergefell: But This Does Not Mean SCOTUS Won't Take Up the Issue in the FuturePart II (06:10 – 11:51)Supreme Court Allows Trump Administration's Transgender Passport Policy to Proceed: Just Look at the ArgumentsSupreme Court Clears Way for Trump Transgender Passport Policy by The New York Times (Abbie VanSickle)Part III (11:51 – 19:50)No, Biological Designation is Not Meaningless and Useless: The LGBTQ Argument on Gender Identity Reveals the IdeologyThe Ruling About Passports Isn't About ID. It's About Social Control. by The New York Times (M. Gessen)Part IV (19:50 – 26:20)16 States Sue the Trump Administration Over ‘Morality of Harm': Christians Certainly Care About a Genuine Morality of Harm, But That Cannot Be Defined by LGBTQ IdeologiesUS judge to block Trump directive to cut ‘gender ideology’ from states’ sex ed materials by USA Today (Reuters)Sign up to receive The Briefing in your inbox every weekday morning.Follow Dr. Mohler:X | Instagram | Facebook | YouTubeFor more information on The Southern Baptist Theological Seminary, go to sbts.edu.For more information on Boyce College, just go to BoyceCollege.com.To write Dr. Mohler or submit a question for The Mailbox, go here.
© 2020-2025 Ivy Podcast Discovery LLC
