Podcast appearances and mentions of Steve Krug

In this month's Aviation Marketing Book Club, we had the absolute pleasure of speaking with Steve Krug, author of Don't Make Me Think—a fan favorite and one of the most practical books on usability out there. This was not only the most expensive book we've featured in our book club this year, but also [...]

In this Checkout episode, we catch up with Pablo Kraus, CEO of ecostore, the sustainable brand that's captured eco-conscious consumers worldwide. Pablo dives into his admiration for Apple's unforgettable in-store experience, the impact that ChatGPT has had on his workflow, and how he keeps his creativity sharp with hands-on side projects. Plus, he shares his go-to book for building customer-centric ecommerce, Don't Make Me Think by Steve Krug, and the value of simple, intuitive design in building trust with customers.Check out our full-length interview with Pablo Kraus here:Sesame Street Meets Sugar Plastics: Pablo Kraus of ecostore reveals 30 Years of Sustainable Innovation | #467About your guest:Pablo Kraus is the CEO of ecostore, a leading environmental brand founded in New Zealand, offering eco-conscious shoppers home, body and baby care products for over 30 years. Available across New Zealand and exporting across the Asia Pacific Region, ecostore has grown to be a brand synonymous with authentic sustainability. In 2021, ecostore became B Corp certified, joining a global network of businesses that meet the highest standards for corporate social responsibility. Pablo was born in Germany but raised in Auckland, New Zealand where he now lives with his wife and two children. About your host:Nathan Bush is the host of the Add To Cart podcast and a leading ecommerce transformation consultant. He has led eCommerce for businesses with revenue $100m+ and has been recognised as one of Australia's Top 50 People in eCommerce four years in a row. You can contact Nathan on LinkedIn, Twitter or via email.Please contact us if you: Want to come on board as an Add To Cart sponsor Are interested in joining Add To Cart as a co-host Have any feedback or suggestions on how to make Add To Cart betterEmail hello@addtocart.com.au We look forward to hearing from you! Hosted on Acast. See acast.com/privacy for more information.

In this episode of the "Uppskill Digital Marketing Podcast," we dive into the game-changing concept of "Don't Make Me Think" from Steve Krug's renowned book on web usability. Why do some websites just feel easy to use while others leave you frustrated? It all comes down to intuitive design and minimizing user effort. Through relatable stories and real-life examples, we explore how simplifying your website can boost engagement, conversions, and overall user satisfaction. If you're a business owner, web designer, or digital marketer, this episode will show you why less thinking leads to more success online. Tune in to learn how to create seamless, no-brainer digital experiences for your users!

Giant Robots On Tour Hosts Sami Birnbaum and Jared Turner introduce Sheng-Hung Lee, a designer, PhD researcher at MIT AgeLab, and board director at the Industrial Designers Society of America. Sheng-Hung shares his journey into design and engineering, emphasizing the importance of interpreting signals in design and the evolving role of designers from problem-solvers to culture shapers. He discusses how designers must now consider broader, systematic issues such as climate change and aging. Sheng-Hung explains that design is a teachable and essential life skill, highlighting the significance of personal experiences and failures in learning design. He elaborates on the concept of signals, explaining that they represent different perspectives and interpretations in design, which are crucial in addressing complex problems. The conversation shifts to practical design applications and Sheng-Hung's work in smart homes for aging populations. He discusses the integration of various smart systems and the importance of designing for different life stages rather than specific age groups. Jared and Sami also engage Sheng-Hung in discussing the worst and best-designed products, where Sheng-Hung mentions his initial skepticism but eventual appreciation for facial recognition technology. MIT AgeLab (https://agelab.mit.edu/) Industrial Designers Society of America (https://www.idsa.org/) Follow Sheng-Hung Lee on LinkedIn (https://www.linkedin.com/in/shenghunglee/). Visit his website: shenghunglee.com (https://www.shenghunglee.com/). Follow thoughtbot on X (https://twitter.com/thoughtbot) or LinkedIn (https://www.linkedin.com/company/150727/). Transcript:  SAMI: Hello again, and this is The Giant Robots Smashing Into Other Giant Robots podcast, the Giant Robots On Tour Series coming to you from Europe, West Asia, and Africa, where we explore the design, development, and business of great products. I'm your host, Sami Birnbaum. JARED: And I'm your other host, Jared Turner. SAMI: If you are wondering, which you might have been for a while now, where are Will or Victoria, well, make sure you find one of our previous podcasts where we introduce the Giant Robots on Tour Series, and you'll understand why you're hearing myself and Jared a little bit more frequently than before. In that podcast, we throw random icebreakers at each other, and we find out that Svenja does not like online banking. And if you haven't listened to our previous podcast with our guest, Ishani, check that out as quick as you can and find out why AI is compared to babies. Joining us today is Sheng-Hung Lee, a Designer and PhD Researcher at MIT AgeLab and Board Director at the Industrial Designers Society of America. Sheng-Hung, I'm going to level with you. I've done my research. I've done my due diligence on the guests that we have on this podcast, and I'm exhausted. SHENG-HUNG: [laughs] SAMI: I've looked through your own website, and I've read as much as I can find about you. And between education, experience, awards, scholarships, there is an incredible amount of things that you're involved in that you get up to. And it really wasn't good for my own self-esteem just to see how much you have going on. SHENG-HUNG: [laughs] SAMI: Jared, a question for you first. Bear in mind, the only thing I've ever been awarded is my own driving license. So, our guest, Sheng-Hung, how many awards do you think he has currently listed on his website? Give a guess. JARED: Oh gosh, I remember looking at the page, and I remember having to scroll. SAMI: [laughs] Yeah, you had to scroll. JARED: Let's pick 33. SAMI: 33. Do you know what? It's not even close. Okay, he's nearly double that. So, he's up at 60 awards that are currently listed. So, we're talking about a guest that you guys do not want to miss. And you want to make sure that you get into this conversation. I always like to go back to the start with my guests. So, everyone has a story. And I'm interested, Sheng-Hung, in your journey and what led you into the world of design and engineering. SHENG-HUNG: My personal definition of design is, like, decoding signals. So, everything in our lives, like, we have different types of signals. How do we interpret the signal? How do we, like, understand, or perceive different types of signals in our lives? And I feel design is more like...not just creation. It is creation, for sure, but also about curation. I feel like, for me, problem-solving or, like, problem-defining is really interesting. And especially you mentioned, like, my very early stage as a designer, the reason I submitted my work to get an award is because I want to show my problem-solving skill. And I realize nowadays, like, the problem is too complicated. It's not just about solving problems, right? I mean, I feel design is more bigger than that, especially now most of the problems are systematic and complex. Climate change, right? Like, you think about aging, and you think about all this, like, sustainable issues. I feel like designers, like, for me, starting from problem solver, as engineer, and now more I've become like a translator, curator, or even, like, a culture shaper. How do you shape the culture you want, right? Especially now, like, AI it's just, like...that really let me rethink about my role as designer, you know, because everyone can have tons of ideas, but the truth is, like, we have so many ideas, but do you know what good taste is about? Do you know what the good qualities of life's about? So, you have to have some personal experiences to really help people to understand or curate the vision in the future. SAMI: That's really interesting. I struggle to dress my kids in the morning from a design perspective, right? I don't get colors, and I don't understand necessarily how they match and how to get things working. In fact, sometimes I'll dress my kids only to find that my wife has redressed the kids. Things are that bad at home. Do you think then design is something which can be taught, or is it something, like, innate? Is it something, in your own experiences, that it's kind of part of your nature? So, you see the world differently to someone like myself or Jared sees the world. Or could that be something which we could pick up on, you know, and learn about? SHENG-HUNG: Yeah, I definitely think design can be teachable. It's skillable. And I feel like, yeah, people talk about this is, like, a hardcore skill. It's a soft skill. No, I think design is a life skill. It's a human skill. So, that includes like, for example, like, yeah, how do you choose the color? How do you choose the clothes for kids? But also about, like, how do you celebrate the quality of lives, right? How do you, like, have better, like, qualities? And I feel like, I don't know, life skill means, like, team building, creative leadership, knows people, listening to people. And, for me, that's part of design because you're decoding different signals. You understand your life. You perceive different types of noises. Or how do you resonate with other people? And that's a life skill, I think. And I also feel most of the design skills I learned is actually not from school. It's from, like, personal life failure [laughs]. SAMI: That's really interesting. I just want to jump in because I don't know if I fully understand what you mean by signals. Can you just elaborate on that a little bit more? And then, I will bring you back up on personal failures. SHENG-HUNG: Signal is like different ways of seeing things, right? So, for example, like, if I go to wait in line for a free bagel, right? You share this with your friends. What I see is it's a free bagel. But what my friends see is like, oh, probably, like, I don't need to wait in line and so many challenges. You know, I have to, like, oh, why should I get this? But I see very clearly I want a free bagel. So, these are different. It's the same thing but different message mixed up, right? And then, for me, I see design, like, it happens every day. It's a life skill. For example, like, I saw the challenges, but what if we think another perspective to rethink about what kind of challenge [inaudible 06:38] or reframe the right questions, right? And all this, like, mixed all together, it feels like it's not just about drawing beautiful sketches or rendering sexy, you know, ideas. It's all about, like, how do you frame these challenges? How do you look at this? Can you see the question from social aspect, from cultural aspect, or you just see this as a solution-driven approach? JARED: In some cases, I feel, there is an element of subjectivity to the designs, but then we also want to measure the success of a design. Do you have any tips for, like, how you go about putting numbers to what defines success for a particular design? SHENG-HUNG: This is such a great question, especially now my research focus is really on services, you know, service design, experience design. Like, how do you quantify this, right? For example, three of us we go to the restaurant, and I feel it's really, really great restaurant. And probably some people feel no, that's not really great. And then, how do we quantify this, right? And then, I feel it's sometimes, like, really by personal preferences. It's hard to measure. Maybe there will be some sort of, like, a principle direction or criteria we can follow, so, for example, service quality metrics or something, like, based on people's life experiences. I feel it's hard to measure, especially now the design challenge the question it's really complicated. Some people talk about demographic. How do you, like, [inaudible 08:09] design? Like, for example, a participant design process, right? Or, like, inclusiveness. People talk about equity, power, power dynamic. And I think it's less of a measure or quantify. It's more about do you show your respect? Can we be more inclusive in this process? Can we really engage or integrate multiple voices in this design process? And I feel like that kind of shows the flexibility, also, the real flexibility of the design, not just that, oh, we look for one single solution. Because, most of the time, we actually want to design for a solution, but, actually, I feel now the shift is from we try to build the condition to let people land on this condition and solve the problem. So, in the end, we'll be like, yeah, we landed here, and we can solve the problem together collectively. So, something I feel a little bit different, but that's a great question. It's open-ended. Yeah. JARED: Yeah. Thank you. There's a lot to think about there. I want to bring it back to failure because this is something I think about a lot in terms of teaching and learning from history versus learning from your own failure. We have, like, thousands of years of history of failure. You think we have made all the mistakes already, and, oh, it should be easy, right? All we need to do is teach all of the young generation about all of this failure, and then they'll remember not to do it. But in reality, it doesn't really work that way. I find the strength of the argument is oftentimes weak compared to failing yourself and really deeply learning that lesson. I'm curious about your thoughts on that. And then, I'm also curious to hear about some of your, let's call them, best failures. SHENG-HUNG: I personally feel like people fail. They fail forward, not backward. So, even if you fail, you move a little bit. It depends on how crazy, right, and how fast you fail. It's an iterative process. The reason I say learning from failure because from traditional Asian family, Asian students, right? Probably in the past, I would say I raised my hand. I want to learn, or I ask senior people. I want to learn. But, actually, more than that, it says, "I want to experience. I want to be part of it," right? So, you're not becoming the manager because you learn to become a...no, you're in that position, and you learn to be a manager. So, I learned that mindset when I worked at IDEO. And one of the senior design directors told me, "No, you should say, 'I want to experience.'" So, that means that you have fully immersed experiences. And one of the best examples for me is that the first two years I worked at IDEO and IDEO Asia, supporting projects in Tokyo, Shanghai, Singapore offices, and sometimes European, like, office work; the first two years, my confidence almost collapsed. I have to collect my confidence. It's so hard because I'm eager to learn so many things. I didn't beat myself. And then, after two years, I met an amazing, like, design mentor. And I started the things I'm good at as product designer, a tangible designer. I start as product-focused and thinking about whole design process. And then, I start to collect my confidence. And I realized every single project at IDEO or in my life it's a vehicle, you know. And then, you always connect the dots when you're looking backwards. And you realize, oh, this is failure. Let me know what do you mean by client management? What do you mean by, like, teamworking? Because everyone is from so diverse background. And everyone says, "I'm a designer," but they have different interpretation. And how do you communicate it, right? And how do you keep the conversation transparent and also effective, and how do you empower people? And I feel because of that connect the dots process, also, all the things I want to learn, I want to experience it really helps me to grow at the third year or second year in IDEO. And that really makes me think about, oh, wow, I didn't know. I failed completely. And that's really healthy, for me, because you become very strong. At some point, I started to realize, oh, what do you mean by...what does it mean by design consultancy business? What we can sell. Where's our capacity, our limitation? You know, other than just, oh, everything's, like, imaginative conceptual. I kind of know what happened, and I know the boundary. And I know how can I empower people and also the client. SAMI: Yeah, embracing failure is a real strength. At thoughtbot, we kind of...if we're developing products and we're, let's say, designing or coding, whether websites or applications, we have this concept of failing fast. So, the faster you can fail, the quicker you can iterate towards the right solution. And that's something which is difficult to embrace because the first time you do it, I want this to be perfect, and I want to build it in the way that it works. But, actually, you'll spend a lot of time trying to get towards that perfection, and it's much better to ship faster, fail faster, and then get towards the solution. I noticed as well that...well, I read that the one thing you've been recently working on is designed for the aging population, so more specifically, smart homes for the aging populations. Shout out to my parents if they're looking for a smart home. Sorry, mom and dad. SHENG-HUNG: [laughs] SAMI: I've always found, especially my generation, so I'm about...I'm not about; I am 32 years [chuckles] old. So yeah, there's always been, like, a big gap between kind of my generation, the way we've engaged with technology products, the way my parents' generation have been able to. And I imagine a future where my kids are running around in VR headsets, and I'm still, you know, using a basic laptop. I would love to know more about your work kind of in this area and designing for a different sector of the population. SHENG-HUNG: My master thesis and my master project is focused on redesigning, like, smart footwear for aging population, and then that's part of the smart home ecosystem. And I was actually impressed and surprised. It's like most of the sponsors or clients we talk about, like, people [inaudible 14:38] to think about just the product level, so smart like [inaudible 14:43], smart like a door, or smart like, you know, like a bed or a smart, like, alarm clock. People start to think about how can we integrate all this system together? Because, like, for example, if you bought Amazon, you know, versus Apple and all these different devices, the platform is really a problem because the products cannot communicate with each other. And we want to make sure all the products can communicate and support you, or, like, they can at least receive your data or information to give the appropriate response. So, the smart home project starts to think about from ideas to become more like platform integration. IKEA is the best example, right? Like, I think two years ago, they talk about, yeah, they launched their first app, right? Everything is, yeah, it seems like, oh, what's the big deal about this, right? No, but you think of this from the intention perspective to actually connect the whole system together because they want to make sure their internal designer, developer they really can think through their own internal system to make sure everything's connected, interconnected, not just, oh, you do a part of this. We sell this to a certain Asian, and it didn't really connect. So, I feel like when we designed it, it's really from the system perspective to talk about a smart home. And then, regarding of, like, design across [inaudible 16:04] generation, that's really important, actually, because especially now I'm focused on design for retirement. And I shifted to design for longevity. And then, the cool thing about this is, like, we think about our life in terms of age, but, actually, now we need to think about our life in terms of different life stages, different lifestyle. The book called "Stage (Not Age)", means, like, now we cannot even describe people above 100 years old or 85 years. So, we call them future hood, right? So, like, different life stages. And I feel like that really impacts, as designers, the way we design products or interfaces, right? And it has to evolve with people. When you say, for example, if we have, like, a smart, like, a robot in our home, they have to know your personal routine. And you kind of grow, right? For example, oh, I get older. I move slower, or my mobility is different, and it changes. How does that mean to our product or our smart services? And I feel like across different generations, it's really thinking about design for different people in different life stages. And that's really important, not just about financial planning or about your future education, family, community, right? Now people are probably thinking about aging in place. My parents just bought a second home. They're thinking about retirement life. And so, these are things that really impact all aspects of life. And I feel like the idea of one solution for all the era is kind of over because we have to think about not just one solution, multiple solution tailor-made for multiple different people in different life stages. MID-ROLL AD: Are you an entrepreneur or start-up founder looking to gain confidence in the way forward for your idea? At thoughtbot, we know you're tight on time and investment, which is why we've created targeted 1-hour remote workshops to help you develop a concrete plan for your product's next steps. Over four interactive sessions, we work with you on research, product design sprint, critical path, and presentation prep so that you and your team are better equipped with the skills and knowledge for success. Find out how we can help you move the needle at: tbot.io/entrepreneurs. JARED: And, Sheng-Hung, in one of your articles that I was reading about design for longevity, you sort of say that design for aging isn't just about designing for older people, but rather, I think one of your colleagues asked this question, which I really liked, which is, how can inclusive methods build elegant design solutions that work for all? And I find that a really aspirational goal. But one of the things, say, at thoughtbot, when they're building a product, so we often talk about targeting a specific niche or a specific user base because then we can really optimize for them. And so, you're designing something that's elegant, and that works for all. It doesn't sound very easy. It sounds like a good challenge. And I'm curious about how do you go about that, and do you have any examples you can you can share? SHENG-HUNG: Design for all elegantly also seamlessly. Optimize everyone's needs or, like, design process. I feel...because my topic is focused on financial planning, right? And I think about everyone's income level is different. Their investable income asset is also different. We have a different situation, right? Our family issue, the healthcare condition is also different. And I feel like that, also, if we look at this question, we should think about, okay, how do we define design for all, right? Is it universal design, or is it inclusive design? I think there are definitely some, like, basic or fundamental, like, foundation or criteria we need to meet. Like, for example, human-centered, right? Or, like, we think about accessibility for certain technology. What's the threshold for a certain way of use the technology or product? That could be, like, a universal or, like, basic. Like I said, people's life stages are so different. And can we really make sure our product or interfaces is always dynamic, always change? Design for transformation, right? And I feel the ideas of changing is kind of scaring for most people. Because you don't want to, like, you woke up, and you realize your iPhone just update the whole interfaces, and you suddenly don't know how to use it [laughs]. It changed too dramatically. What I mean by change is like, it's a gradual integration process. And I feel that's kind of beautiful. Like, for example, the way I use my bicycle, the biking, right? They can ultimately adjust my speed, recharging, or understand my personal preferences. That could be something I think is powerful for future for providing the right solution, yeah. But also, it's a benefit of this, but also, there's downsides. Like, maybe because of that, we all live our own personal bubbles pretty well, right? Like, oh, yeah, yeah, I read a newspaper. No, you read the newspaper that I curated for you. So, somehow, the information started different [laughs]. So, there's a gap, but I don't know. It's very cool. It's very great, great question. I think there's still...I don't have the exact same answer, but I feel that could be potential for now. Yeah. JARED: Yeah, I really like that. So, it's not just a one-size-fits-all-all, but, like, it's a sort of an elegant transformation over the course of someone's life. We've discussed a few different things like design for longevity. You touched on there, as we were speaking, human-centered design. I know you've made a distinction of humanity-centered design as well, and there's also life-centered design. I wonder if you could give us and our listeners a little rapid-fire explainer of each of them. SHENG-HUNG: Like, when we talk about human-centered design, right? Like, it's, like, a buzzword. And everyone talks about HCD, and most people think, oh, if you got a post-it note, you're, like, a HCD designer. No, like, what does that mean, right [laughs]? It's very cliché. And they're like, oh, yeah, all these, like, HCD designers bring the post-it notes with Sharpies and go to facilitate tons of workshops, and they sit and know people. And I feel it's more than that, right? Human-centered is really, like, put yourself, designers, in the shoes of clients, users, customers, and participants to know their needs, their desire and address their pain point. And I think for human-centered design like Don Norman said in his latest book, it's not just about design as a discipline. It also covers, like, politics, covers, like, ethical issue, culture. It's broader. And, for me, the simplest version is, like, you design with care. You design with human temperature. We create technology with human temperature. That means that we're now for this technology to [inaudible 23:13] technology. We know why we need that technology. So, for example, if you provide the, like, the cell phone to the developing countries, you probably don't want to send, like, the latest cell phone. You want to send them, like, the adequate technology. What I mean by that is like, it's very, like, stereotype, but I'm trying to explain the idea is like, oh, Nokia could be a great option at this point, for example. You can communicate. You don't need, like, crazy, like, AR VR function. You at least can communicate. So, it's adequate. I think that kind of lens is, like, you think about the culture, the needs, economic, social status. And then, you can start to move on and upgrade the devices. And I feel like life-centered is even broader. It's like, can you design something to the lens of cats, your pets, your animals? So, it's really like, it's really...it sounds a little bit like a speculative design. But the truth is, like, we can shift our perspective to different kinds of species, cross-species, not just focus on human, because everything we design definitely starts from also for a human being. But now life-centered is like, it's longer, broader. And then, for me, it also means like, we just talk about life-centered. It's like, really think through all different stages of life, not just, like, focus on one single age or a single stage, too specific, too narrow. It's, like, broader. So, when we talk about life-centered design, LCD, we really think about a lot of different systems, framework. What's the model we can follow? You know, so we're also thinking about policy, about power dynamic, government, ethical issues. So, this, I think, like, it's broader, and it's really large. Sometimes it's pretty vague, for sure. We have to use some cases or really think about in different contexts. Context is really important, designed for different contextual knowledges and needs. SAMI: Yeah, I think that is actually a really helpful understanding. Myself I don't know anything about those concepts, so to kind of get that theoretical understanding and explanation from yourself is really helpful. In a more practical sense, I have a question, which is a very selfish question. The reason it's a selfish question is because I want to know what do you think? When you look at the world through your designer lenses, what do you think is the worst-designed product you've ever seen or come across? And I think I know the answer to this. I think there is a right answer. While you have a think, I'll share my answer. I don't know if you have this because you said you're based in Boston at the moment. And I'm showing you because we're on camera, but I will describe it to the listeners as well is what they've done with bottles now is when you open, like, a Coke bottle, for example, all other beverages are available...Coke, if you want to sponsor us [laughter], we're happy just to mention you. When you take the bottle cap off, it's now connected to the top of the bottle. So, someone has decided...now, I understand the reason behind it. They're saying that it's for recycling. So, when you throw your bottle away, make sure the cap goes with the bottle. But someone has sat there, and they've designed the bottles. So, when you take off the cap, it's still connected to the top of the bottle. And countless times, I'm either pouring into a cup or pouring into my mouth. And that cap is getting in the way. So, the liquid kind of goes into that cap, and it spills on me, or it spills on the table. This is an absolute design failure, a catastrophe in my eyes. That's my worst design that I've come across in real life. Do you have anything you can think of that you look at, and you're like, who designed this? SHENG-HUNG: This is such a great example because I did have similar experiences when I went to Milan Design Week last year. All the plastic bottle is, like, connected. The cap connects with the bottle. And I didn't know that it's on purpose at the very beginning. I thought, how come it's, like, connected? I want to take it out because it's easier for me to drink. And I realized it's not just this one; all of them is the same [laughs]. Yeah, that's a great example. I think, for me, design for failure adapter, for example, you know, adapter, like dongle, right? Like, we have so many different...this guy HDMI cable, the cable for iPhone, and the magnet for my Apple MacBook Pro. That's painful because you try to find, like, when you go to, like, a talk or a speech or try to present something, I think, for me, the easiest way is, like, AirPlay, right, Wi-Fi or Bluetooth to connect to the projector. But in reality, you always need this HDMI cable. And this guy connects with my Mac. There's some problem. It depends on...now I always bring my adapter with me. It's just like, we have that [inaudible 28:04] like, you know, it almost, like, very frequently, if we're meeting, you have to show your screen. How can we design less physical but it's user-friendly, right? People use Mac. People use Apple, use, like, Microsoft. How do you design something like a universal adaptable to everyones, just sharing screen? This is what I need. So, I think this could be one bad design, I think, at this moment [laughs]. SAMI: Yeah, that's a great example as well, and so frustrating. And I wonder if it's, like, a money-making scheme, you know, everyone has their own chargers. And that's a way kind of they make some income as well on the side. Jared, what have you seen in the world? What's your pet peeve? What really grinds your gears? JARED: This was easy for me. It came to me straight away. Any door that has a handle that you can wrap your hand around which signifies it should be pulled that is push. It's just, I mean, what is going on there? It drives me bonkers. SHENG-HUNG: [laughs] SAMI: That is brilliant. I think it's only fair if we flip the question, right? And then, we say, what's the best thing you've seen designed, right? There must be something out there where you've gone, "Oh, that is so useful. That makes so much sense. Why haven't we done that until now?" And have you kind of...I guess this is for Sheng-Hung, like, have you got any inspiration from that sort of thing? SHENG-HUNG: I have to be honest. Like, I really feel like in the past, I'm kind of scared about, like, use your face to unlock your phone. But the more I use it, I feel like, oh my God, this is so convenient. You just look at it. I know it's a bit scary because they have all your biometric data information. I know even you protect under the regular law, but still, I feel like, yeah, it's so seamless connected. And I feel maybe the better answer is like, I feel a great design is, like, to reduce the friction between the transition of devices by devices, right? So, for me, I mean, so interface by interface. So, when I share the data on my phone, what does that mean? From phone to my computer or phone to other people, right? All the different interfaces changing. The less friction, the better. I feel seamless connected. So, you know, AirDrop, super convenient, photos, videos with people, Mac users. But what does that mean for, like, Windows users, right? And so, every platform has their own, like, spec, or criteria. And I feel if the user can feel the seamless friction between these interfaces, for me, that could be a great design solution. JARED: I love that answer. And I love that description of reducing friction. It reminds me a little bit of, I think, my favorite book on UX is by Steve Krug, which is "Don't Make Me Think." And it's just all about doing the simplest thing, reducing confusion, overcoming objections, and reducing friction. So, I really love that. I do have an answer for this one as well. It's a little bit selfish or focused on my own life. So, I have a dog. She's a Welsh Terrier called Rosie. She's just turned one. Whenever we used to go out, you've got to take water for her if it's a hot day. I always used to take a bottle, whether you could unscrew the top or not, I'm not sure, Sami, and, like, a little bowl to put that in, or you use your hands. And, invariably, she's not going to drink all of the water, so you've got waste. You throw that out. The bag gets wet, all of that. Someone has designed this really cool bottle where the top is actually the bowl. It's an all-in-one. And you press a button; the water goes into the bowl. She drinks. Whatever's left, you press the button again, turn it upright. And the water just flows back in into the rest of the bottle. It's such a simple thing. But, like you say, it just reduces that friction. Anytime a problem no longer exists, manual to automatic cars, fight me, I'm all for it. Well, that's a problem solved. That's less friction. That's beauty in the world. SAMI: Yeah, I think it's amazing. When you think about these examples, it really brings out how much of an impact design has. So, you can have the best product in the world, but if you don't get that frictionless design, or you don't get that design that's going to really bring that improvement, it's going to be difficult to make that product a success. And I think there's some, like, when I think about leaders and innovators in this kind of space, so I know you already mentioned IKEA and I think of Apple. And I don't know the answer to this, and maybe our listeners also wonder, like, how do these companies...they seem to keep getting it right. No matter what happens, they seem to set the trends, and they get their design spot-on, and they innovate in that space. How are they so successful in their design? SHENG-HUNG: I think a recent example is like, you know, like, Apple just recently launched the Vision Pro, right? The XR, the goggles. And put the demo time 30 minutes to get in-store experiences. You're booking the demo time with them, the 30 minutes. For me, I wrote an article about it. It is less about the goggle itself. It is about the whole experiences. The time you enter the store, right, and then you're waiting there, who guiding you? The Genius Bar people guiding you. You sit down. You have the prescription and your glasses that get measured, scan the QR code, and find the match [inaudible 33:35] pair of goggles that fit your [inaudible 33:37] of your face. And they put it on. They sit on the side, use the iPad to guiding you, and tell personal experiences or stories. These companies are very design-driven, vision-driven company. They really think about the whole experiences of users, right? And, for me, it's too pricey, for me, the product, obviously, right now. But I have very delightful, positive experiences because of that 30-minute demo. So, I kind of plant the seeds in my heart. Oh, if the second generation or something have discount, I would definitely want to get one for myself. Not really because...it's a great design for sure, but also, the impression I have. And I feel that really, really, like, make a difference, right? It's tiny. It's very subtle. They can, "No, we don't have, like, demo experiences." They can just purely sell the product. But I think they sell something bigger than just product. Branding user experiences, delightful experiences. And I can really feel that, and that's really powerful in the end. JARED: Do you think that that sort of level of design is limited to the companies that can afford it like the big names? Like, obviously, there is a cost dedicated to having the time and to putting the resources to that. Is it always just going to be the big players, or are there things we can do to democratize that availability for the startups, for the SMEs? SHENG-HUNG: I actually think it's about a company's culture. So, another example I would love to share is, like, when we did, like, an inspiration trip in Tokyo, and there's a very famous, like, chain bookstore called Tsutaya bookstore or Tsutaya electrics. So, to my surprise, like, yeah, it's a big bookstore, and we probably think bookstore selling books. No, they're actually selling a lifestyle. So, for example, like, if I want to buy the book around how to use a camera, right, the way they curate it, it's like, yeah, we do have the books around camera, but also, we'll put the real camera, like, near the book. So, they curate the whole experiences. You flip the book. Oh, this is so cool. Thanks, I want to try it. You probably, in the end, you got both. So, very interesting and also very human-centered, like, retail experiences. Why did I say culture? Because when I entered the store, I asked for one book I was looking for. The staff came to me, and she bring two books to me. One is the book I want, unpack. And one is the book...it's the same book, but without the plastic cover. It's brand new. And why she brought two books to me because if I want to buy this book, I not only read inside, but also, I can just get the new one with me to check out. And this is so subtle, right? Because they're not just bringing you, like, the sample. They also bring the final product with you. So, I feel that kind of culture is, like, very strong, customer-centered, think about your needs, think about your next step. So, they kind of plan ahead, and this is so strong message to me. Oh my God, this is such a great design culture, or at least a human-centered culture to think about my needs, my decision-making process. So, I feel connected with that, and I feel like, yes, they have money, but also, like, they really cultivate that culture within the...not just...they also send a message to their customers. SAMI: I feel like, Sheng-Hung, we could speak to you for hours. I mean, you are opening my world and my eyes to a different world of design. I've got one final question for you before we wrap up that I wanted to cover. I've seen from your website, like, you've personally designed products. So, out of all the products you've either designed yourself or you've been involved with, what would you say, and could you describe for us your favorite product that you've designed yourself? SHENG-HUNG: I think my favorite product is, like, I help and re-design, like, Shanghai Library Innovation Space that, for me, is OMG. Oh my God. It's crazy. Like, one single team, my side project and collaborate with the full staff, librarian, the leadership team. What is powerful is, like, library for them in Shanghai, it's a local hub to connect the community and also to teach, to learn for the younger generation how to use the space. For sure, most people use that space for, like, self-studying, you know, activity and all this stuff. But, for me, like, it's so impactful because every single change that means a lot of impact because it's a public space. And also, it's really, really powerful. Like, you think about the decision-making process. You have to think about feasibility, viability, and also desirability, all things to connect together. And it's really hard, not easy process. It took me about a year-long project. And I'm really happy because, in the end, it's really from sketches, concept, prototyping models, all the way they rebuild, modify the design, integrated. And now the new library they build on another area of Shanghai is really based on this model and framework. I'm very happy, and I also feel like, yeah, design can make a positive impact. It's not like a concept. It's real. And it's nice. It's painful, but it's really satisfying, yeah [laughs]. SAMI: That's really cool when you get to a point where you've done something, and then you see people using what you've designed and, like, enjoying that space and benefiting from all that hard work that you've put into. I have to thank you so much for joining us and giving us time today on the Giant Robots On Tour Series of the Giant Robots Smashing Into Other Giant Robots podcast. Our listeners don't know, but you've had about two hours of sleep. SHENG-HUNG: [laughs] Yeah. SAMI: So, it's probably time for you to get back into bed yourself. But that is your dedication to us. It's been an incredible episode and an incredible chat. I finally understand why Jared does not like doors. I myself, you will understand if you see me in the street and I'm tearing a bottle cap off of a bottle, you'll understand why. And we need to sort Sheng-Hung out with more adapters with just a single charger for all his devices. If people want to get a hold of you, Sheng-Hung, where's the best place they can reach out after listening to this podcast? SHENG-HUNG: Yeah, definitely, you can reach out through my personal website portfolio. Yeah, shenghunglee.com. And I'm happy to respond and discuss about design-related topic. Thanks for having me on this podcast. It's very exciting, and hope we can create all the great stuff for our society. SAMI: Pleasure. There's always a challenge I give to my listeners at the end, and it normally is just please hit that subscribe button. Jared has promised me that he will do a shoey if we can double our subscribers by the end of the series. If you don't know what a shoey is, my only advice to you is do not Google it because you do not want to know. You can find notes and a complete transcript for this episode at giantrobots.fm. If you have any questions or comments, you can email us at hosts@giantrobots.fm. This podcast is brought to you by thoughtbot and produced and edited by Mandy Moore. Thanks for listening. See ya. AD: Did you know thoughtbot has a referral program? If you introduce us to someone looking for a design or development partner, we will compensate you if they decide to work with us. More info on our website at: tbot.io/referral. Or you can email us at: referrals@thoughtbot.com with any questions.

Olá, pessoal! Mais uma das lives da nossa Semana do UX Decodificado. Neste evento especial, vamos bater um papo com Rafael Frota trazendo diversas referências e recomendações de livros para enriquecer ainda mais seu conhecimento em UX. "UX Decodificado" foi escrito para fornecer um guia completo e prático sobre UX, destinado a novos designers, profissionais em transição, gestores, desenvolvedores e inovadores. O objetivo é disseminar conhecimentos valiosos, promover uma cultura de design centrada no usuário e ajudar profissionais a aplicarem práticas de UX de forma eficaz em seus projetos e carreiras. Já comprou o nosso livro "UX Decodificado"? Se você é um designer em busca de aprimorar suas habilidades em UX, ou um profissional de outra área interessado em migrar para o design de experiência, este livro é para você. Adquira já o seu exemplar e leve sua carreira para o próximo nível! Edição Física (Site da brauer) Amazon Brasil: https://amzn.to/3Wv4zVb (Versão Digital em português) Amazon Espanha: Compre agora! (Versão Digital em português) Amazon UK: Compre Agora! (Versão Digital em português) Livros Recomendados "Don't Make Me Think" de Steve Krug https://amzn.to/4fxgTNF Um guia clássico para a usabilidade de websites e produtos digitais. "The Design of Everyday Things" de Don Norman https://amzn.to/3WMQXGp Uma leitura fundamental para entender os princípios do design centrado no usuário. "About Face: The Essentials of Interaction Design" de Alan Cooper, Robert Reimann, David Cronin e Christopher Noessel https://amzn.to/3WN7FoX Um manual completo sobre design de interação e usabilidade. "Lean UX: Applying Lean Principles to Improve User Experience" de Jeff Gothelf e Josh Seiden https://amzn.to/3A5PNgn Um guia prático para integrar UX e métodos Lean em projetos de design. "Seductive Interaction Design: Creating Playful, Fun, and Effective User Experiences" de Stephen Anderson https://amzn.to/46smPTT Foca em como criar designs que engajem e encantem os usuários. Profissionais Referência Don Norman Steve Krug Jeff Gothelf Alan Cooper Tem varios brasileiros citados no livro. Recomendo buscar. Alem claro dos que tem passado por aqui no bom dia ux e nesta semana. Sobre carreira: com ebooks Joe Natoli https://givegoodux.com/books/ Artiom Dashinsky https://dashinsky.com/ Álvaro Souza https://www.aprenderux.com.br/ Arquitetura de informacao Abbey covert e sua comunidade The Sensemakers Club https://www.thesensemakersclub.com/ Mercado, lideranca e metricas Jared Spool e a comunidade Leaders of Awesomeness Inerface, interacao e UI FeUX www.youtube.com/@feuxdesign Comunidades Jovens uxui Vagas ux https://vagasux.com.br/ Sites Recomendados para Aprender Sobre UX Nielsen Norman Group (NNG) nngroup.com Oferece uma vasta gama de artigos, relatórios e vídeos sobre pesquisa e prática de usabilidade e UX. É uma das fontes mais respeitadas no campo. Smashing Magazine smashingmagazine.com Publica artigos detalhados, tutoriais e recursos sobre design, desenvolvimento web, e UX. A List Apart alistapart.com Foca em padrões web, design e desenvolvimento, oferecendo artigos de alta qualidade sobre UX e UI. UX Design.cc uxdesign.cc Uma plataforma que reúne artigos, tutoriais, e links úteis sobre design de experiência do usuário. Interaction Design Foundation interaction-design.org Oferece cursos online, artigos e uma comunidade ativa para quem deseja aprender mais sobre UX. UX Matters uxmatters.com Publica artigos e colunas de especialistas em UX sobre uma ampla variedade de tópicos relacionados ao design de experiência do usuário. Usability.gov usability.gov Mantido pelo governo dos EUA, oferece recursos, guias e melhores práticas para criar interfaces centradas no usuário. Boxes and Arrows boxesandarrows.com Uma revista online que discute design de interação, arquitetura da informação e design centrado no usuário. UX Booth uxbooth.com Um blog colaborativo que cobre diversos aspectos do design de experiência do usuário. Medium – UX Collective uxdesign.cc Uma coleção de artigos escritos por profissionais de UX sobre tendências, práticas e estudos de caso. Esses livros, sites e profissionais são altamente recomendados para qualquer pessoa interessada em aprofundar seus conhecimentos em UX. Eles fornecem uma base sólida e insights valiosos que complementam os ensinamentos do livro "UX Decodificado". Adquira já o seu exemplar e leve sua carreira para o próximo nível! https://lnkd.in/dTU9S_Da

Welcome to nohacks.show, a weekly podcast where smart people talk to you about better online experiences!In this episode, I welcome Linda Bustos, Founder @ Edgacent & Ecom

We discuss one of our favorite UX classics: Don't Make Me Think, by Steve Krug

Resources: Tools: Figma, Sketch, Adobe XD for wireframing and prototyping. InVision, Marvel for creating interactive prototypes. Books: "Don't Make Me Think" by Steve Krug. "Information Architecture: For the Web and Beyond" by Louis Rosenfeld and Peter Morville. Courses: Mentorship programs on UX Design & Online courses on platforms like LinkedIn Learning. Websites: Nielsen Norman Group (nngroup.com) for UX research insights. Smashing Magazine (smashingmagazine.com) for design articles.

In this episode, we explore design leadership and entrepreneurship with Cameron Ridenour, Chief Design Officer of CoNote. Cameron brings listeners into the process of novel product design - highlighting the intricate journey of aligning user requirements with a company's strategic goals. Mark and Cameron discuss transitioning from a traditional design roles to a co-founders and product leaders.This is a great episode for UX Design leaders who are interested in strategies for harmonizing often conflicting aspects of product development. Through practical, real-world examples, listeners gain an understanding of how to maintain a clear and consistent product design direction, even when faced with varying user feedback or short-term opportunities from stakeholders.TOPICS:1. Non-Traditional Paths to Design Leadership2. The Evolution of UX Research Tools3. Balancing User-Centric Design with Commercial Viability4. The Role of UX in Product Development at Startups5. Managing Technical Debt in UX Design6. User-Centered Design Across Different Mediums7. Building a Cohesive Design Team8. UX Leadership and Positive Team Culture9. AI in UX: Enhancing Research and Synthesis10. Tools and Strategies for Effective Research SynthesisLINKS:Cameron Ridenour on LinkedIn: https://www.linkedin.com/in/voltronfutura/CoNote: www.conote.aiDon't Make Me Think by Steve Krug : https://sensible.com/dont-make-me-think/Fuzzy Math: fuzzymath.comMark on LinkedIn: https://www.linkedin.com/in/markbaldino/Fuzzy Math: fuzzymath.com Mark on LinkedIn: https://www.linkedin.com/in/markbaldino/

No mais recente episódio do Emílias Podcast - Mulheres na Computação, recebemos Karine Liuti, uma Engenheira de Software na Collective Health, com sede em São Francisco, Califórnia. Conduzido por Adolfo Neto, professor da UTFPR Curitiba, e pela professora Maria Claudia Emer, coordenadora do Programa de Extensão Emílias Armação em Bits, este episódio oferece uma visão envolvente sobre a trajetória e as experiências de Karine no mundo da tecnologia. Assista em vídeo em https://youtu.be/MzS0DRO6krI Karine compartilha como seu interesse pela computação surgiu e discute sua jornada na Collective Health, destacando sua apreciação pelo trabalho remoto e descrevendo como se tornou uma Lead Software Engineer. Ao longo da conversa, Karine revela as responsabilidades de uma Engenheira de Software Líder e as tecnologias em que ela trabalha. Ela também compartilha sua experiência como co-fundadora da HACKFAESA. Linkedin: https://www.linkedin.com/in/karine-liuti/ Twitter: https://twitter.com/KarineLiuti  Linktree: https://linktr.ee/karineliuti  Mulheres que a inspiram: Roberta Arcoverde Camila Calazans jogadora Marta Sheryl Sandberg Links: TechLadies: https://chat.whatsapp.com/GaiVngesdHxC55dToPqiYB Techgirls ES: https://chat.whatsapp.com/CBGSRUOiKacEaiSpOofQvD  Indicações Karine: Codecon Feature https://www.codecon.dev/feature  Livros Geração de Valor 1, 2 e 3 https://bit.ly/3YKDrm2  Livro Faça Acontecer https://www.goodreads.com/book/show/17703247-fa-a-acontecer?  Livro Reinventando as Organizações https://www.goodreads.com/book/show/38712442-reinventando-as-organiza-es Livro Refatoração https://www.goodreads.com/book/show/54245703-refatora-o Livro Não me faça pensar https://www.amazon.com.br/N%C3%A3o-fa%C3%A7a-pensar-Steve-Krug/dp/8576088509   Indicações Adolfo: Devs40+ https://www.devs40mais.com.br/  Elixir Fortaleza Conf 2023 https://elixiremfoco.github.io/elixirfortaleza  Only Murders in the Building https://www.imdb.com/title/tt11691774/  Ame-a ou Deixe-a Vancouver https://www.imdb.com/title/tt2665420/ Podcast Sociedade da IA (Camila Souza - egressa Cin UFPE) https://open.spotify.com/show/4yZYEuPwStYfQnfIeVkVhb  Professores(as) brasileiro(a)s no Canadá e no mundo https://bit.ly/3v8di3n Entrevistadores: Adolfo Neto e Maria Claudia Emer. O Emílias Podcast é um projeto de extensão da UTFPR Curitiba. Descubra tudo sobre o programa Emílias - Armação em Bits em ⁠⁠⁠https://linktr.ee/Emilias⁠. #PODCAST #EMILIAS --- Send in a voice message: https://podcasters.spotify.com/pod/show/emilias-podcast/message

On this episode, we're diving into the world of Agile Thinking with our guest, Kevin Philpott, Director of Product Design at Pie Insurance. Pie Insurance is a venture-backed insurtech startup, having raised over $600 million in funding since its inception in 2017. Kevin, who has been with Pie Insurance from the very start, is now responsible for all B2B, B2C, and enterprise digital interfaces. Prior to Pie, Kevin held senior product design roles at companies such as RapidFinance, part of the Quicken Loans Family of Companies, and GEICO. His experience across small, medium, and enterprise-sized companies gives him a unique perspective on the Agile Thinking challenges that occur in different business environments. In this episode, Kevin shares his insights on building a culture of Agile Thinking. He emphasizes the "think big, start small, learn fast" mentality and the importance of focusing on outcomes over outputs. He stresses that the role UX can play in developing an Agile Thinking culture extends far beyond wireframes and pixels and reaches into areas like user research and deeply understanding quantitative metrics. Kevin also discusses the value of failure and learning, the power of trust in product development, and the need for a user-centric approach in product design. Whether you're a product leader looking to shift your team's focus towards Agile Thinking or a UX designer eager to make a bigger impact, this episode is packed with practical insights and actionable advice.   Resources: Connect with Kevin on LinkedIn Learn more about Pie Insurance at pieinsurance.com Read "Don't Make Me Think" by Steve Krug   Learn more and get the full show notes at: 3PillarGlobal.com   Produced by Nova Media

Die Podcastfolge zu unserem Meetup: Wir haben wieder das Vergnügen mit Adam Bien zu quatschen. Diesmal diskutieren wir das eventuell kontroverse Thema der Web Components und besprechen, wie produktiv man Webanwendungen mithilfe von Web Components und ohne zusätzliche Frameworks entwickeln kann.Adam teilt seine Erfahrung mit uns, wie Web Components dabei helfen können, Entwicklungszeiten zu verkürzen und die Codebasis zu vereinfachen. Er erläutert die Vorteile der Verwendung von Web Components im Vergleich zu Frameworks wie Angular, React oder Vue.js. Außerdem gibt er Einblicke in bewährte Designprinzipien, Strukturierung von Projekten und die Integration von Tooling in den Entwicklungsprozess, um die Produktivität zu maximieren.Adam Biens praxisnahe Ansätze werden sicherlich inspirieren und dir neue Perspektiven eröffnen.Picks of the Day: Jojo: Hugging Chat – HuggingChat ist eine Open -Source-Alternative zu ChatGPT. Es basiert auf dem OpenAssistant-Projekt von Hugging Face und dem LLaMA Sprachmodell von Facebook. Hugging Chat bietet eine ähnliche Oberfläche und vergleichbare Performance zu ChatGPT, wurde bisher nur auf Instruktionen und noch nicht mit RHLF getunt. Adam: Don't Make Me Think – "Don't Make Me Think" von Steve Krug ist ein oft zitiertes Buch für Webdesign und Usability. Es ermutigt dazu, Websites so zu gestalten, dass sie für Benutzer:innen intuitiv und mühelos zu bedienen sind, ohne dass sie unnötig nachdenken müssen.  Adam: GraalVM – GraalVM ist eine universelle virtuelle Maschine, die es Entwickler:innen erlaubt, Programme in verschiedenen Sprachen wie Java, JavaScript, Python auszuführen und eine Kommunikation zwischen den Teilen in verschiedenen Programmiersprachen ermöglicht. Sie bietet eine hohe Leistung bei geringem Ressourcenverbrauch und nahtlose Integration verschiedener Sprachen in einer einzigen Umgebung.  Fabian: Zed Editor – Zed ist ein leistungsstarker Texteditor, der sich durch seine Performance, integrierte Kollaborationsfunktionen und Anpassungsmöglichkeiten auszeichnet. Der Editor befindet sich aktuell in der Entwicklung, kann aber als Beta-Version heruntergeladen und getestet werden. Adam: Warp Terminal – Warp ist ein modernes Terminal, das in Rust geschrieben und damit sehr schnell ist. Es bietet viele hilfreiche Features wie das Anzeigen einzelner Ausgaben in Blöcken, die geteilt oder kopiert werden können. Außerdem erlaubt es in der neuesten Version die Integration von AI-Tools und den direkten Zugriff auf die Dokumentation.  Fabian: Builder IO Blog – Im Blog von Builder IO findet ihr viele spannende Artikel zu aktuellen Entwicklungen, aber auch zu grundsätzlichen Konzepten in der Entwicklung. Auf jeden Fall mal einen kurzen Besuch wert, der wahrscheinlich in ein längeres Verweilen auf der Seite ausarten wird. Schreibt uns! Schickt uns eure Themenwünsche und euer Feedback: podcast@programmier.barFolgt uns! Bleibt auf dem Laufenden über zukünftige Folgen und virtuelle Meetups und beteiligt euch an Community-Diskussionen. TwitterInstagramFacebookMeetupYouTubeMusik:

Guest Ashlyn Knox Panelist Richard Littauer Show Notes Hello and welcome to Sustain Open Source Design! The podcast where we talk about sustaining open source with design. Learn how we, as designers, interface with open source in a sustainable way, how we integrate into different communities, and how we as coders, work with other designers. Richard is the sole panelist today and he welcomes guest, Ashlyn Knox, who's a web developer, UI/UX designer, and community contributor, joining us from the Fedora community. Today, Ashlyn talks about their work doing front-end development and design for their websites and apps team. They discuss the Fedora website revamp project, people involved, and the funding. They describe their experience with code switching and a design problem they faced while working on the navbar and how they solved it. Then, Ashlyn fills us in on the usability studies for the Fedora Project Website Revamp, using Penpot prototypes tested with real users, and how they believe a closer connection between design and dev teams is so important to improve design in open source projects. Download this episode now to hear more! [00:01:15] Ashlyn tells us what they do at Fedora, primarily doing front-end development and design work. [00:03:02] The revamp of the Fedora website has been a large project, and Ashlyn fills us in on the people involved, the process, and how the funding for Fedora comes from Red Hat and sponsors. [00:05:14] We hear about the stakeholders that they negotiate with as far as the decision making with the website. [00:07:18] Ashlyn discusses their experience with code switching between design and development and how they need space to switch between the two. [00:09:28] Ashlyn describes a particular design problem they faced while working on the navbar and how she needed a structured approach to solve it. [00:11:08] We hear Ashlyn's history and how they were interested in coding as a kid but pursued a career in music teaching until the pandemic, which led them to taking a Bootcamp course. [00:12:47] They tell us about some of their previous projects and how it's gone to design and build websites, as well as finding clients. [00:14:49] Ashlyn explains more about the usability studies for the Fedora Revamp Project and how that went. They mention an amazing book on usability studies they read called, Don't Make Me Think. [00:17:33] Richard wonders how many people they had in their earliest usability study, where did they find them, and why is usability in the design process for open source projects seem so rare. [00:19:09] The prototypes were built using Penpot, a Figma tool, and tested with real users. Ashlyn talks about having a close relationship between the development and design teams and how they acted as a bridge between the two during the project. [00:21:01] Ashlyn shares that acknowledging the differences in languages and being okay with learning from each other can help make teams stronger and reduce miscommunication and friction. They also tell us how mentorship plays a crucial role and how they taught designers how to work with developers. [00:24:42] Find out where you can follow Ashlyn on the web. Quotes [00:07:35] On Design: “Basically, I put that part of my brain into a box, and I just run with the other part of it.” [00:21:09] “I think the acknowledgement of speaking different languages needs to be made and people just need to be okay with that and with learning other's languages.” Spotlight [00:25:16] Richard's spotlight is his high school art teacher, Mrs. Rosoff. [00:25:46] Ashlyn's spotlight is Tony Grimes at the Southern Alberta Institute of Technology and Máirín Duffy with the Fedora Project. Links Open Source Design Twitter (https://twitter.com/opensrcdesign) Open Source Design (https://opensourcedesign.net/) Sustain Design & UX working group (https://discourse.sustainoss.org/t/design-ux-working-group/348) SustainOSS Discourse (https://discourse.sustainoss.org/) Sustain Open Source Twitter (https://twitter.com/sustainoss?lang=en) Richard Littauer Twitter (https://twitter.com/richlitt?ref_src=twsrc%5Egoogle%7Ctwcamp%5Eserp%7Ctwgr%5Eauthor) Fedora (https://fedoraproject.org/) Sustain Open Source Design Podcast-Episode 35: Marie Nordin and Helping the Under-represented in Open Source (https://sosdesign.sustainoss.org/35) Fedora Community (https://fedoracommunity.org/northam) [Don't Make Me Think by Steve Krug](https://en.wikipedia.org/wiki/Don%27tMakeMeThink)_ Penpot (https://penpot.app/) Tony Grimes LinkedIn (https://ca.linkedin.com/in/tony-grimes-778ba135) Máirín Duffy LinkedIn (https://www.linkedin.com/in/mairinduffy) Credits Produced by Richard Littauer (https://www.burntfen.com/) Edited by Paul M. Bahr at Peachtree Sound (https://www.peachtreesound.com/) Show notes by DeAnn Bahr Peachtree Sound (https://www.peachtreesound.com/) Special Guest: Ashlyn Knox.

O mercado endereçável para uma empresa de finanças, como a Warren, passa das 100 milhões de pessoas no Brasil. Isso obriga os gestores a manter o foco nos objetivos principais, sem ceder à tentação de abraçar muitos objetivos ao mesmo tempo. Biografia do Steve Jobs: https://www.amazon.com.br/Steve-Jobs-Walter-Isaacson/dp/8535919716. Livro 'Não me Faça Pensar': https://www.amazon.com.br/N%C3%A3o-fa%C3%A7a-pensar-Steve-Krug/dp/8576088509/. Com: Tito Gusmão https://www.linkedin.com/in/titogusmão, fundador e CEO da Warren https://warren.com.br/, e Fabiana Amaral https://www.linkedin.com/in/fabianakortedoamaral/, Executive Growth Director da MATH Marketing https://math.marketing/; e Marcel Ghiraldini https://www.linkedin.com/in/marcelghiraldini, Chief Growth Officer da MATH Group https://math.marketing/. Apresentação: Cassio Politi https://www.linkedin.com/in/cassiopoliti/.

Det andra avsnittet av fem som görs i samarbete med Conversionista där vi utforskar olika områden inom CRO. Både hur vi jobbar idag och hur vi kan komma att arbeta i framtiden. Tillsammans med Kajsa Hedqvist som är conversion specialist och expert på tester så pratar vi i det här avsnittet om experiment och tester. Allt från varför det är så viktigt till experimentprocessen och vad experimentdesign är. Och rollen experiment fyller i målstyrning och beslutsfattande. För experiment och tester kan användas för att optimera mot fler typer av mål än slutkonvertering och köp. Det handlar snarare om att lära känna sina kunder och deras beteende så bra som möjligt. Om gästen Kajsa Hedqvist är conversion specialist och en del av experimentteamet på Conversionista i Stockholm. Hon har jobbat på företaget i 6,5 år och har under den tiden arbetat med allt från research och användningstester till webbanalys och att sätta upp tester operativt. Idag fokuserar hon framförallt på struktur och planering kring arbetet för att skapa datadrivna experimentprocesser. Kajsa har akademisk bakgrund från Medieteknik på KTH och brinner för att förstå människor, deras problem och hjälpa dem nå sina mål. Det kommer du förstå när du lyssnar på avsnittet. Och utöver sin roll som konverteringsspecialist så är Kajsa även livscoach. Om avsnittet Kajsa och jag pratar i avsnittet om vad experiment och experimentdesign är och varför det är så viktigt viktigt för att lyckas idag. Och hur hon ser att konverteringsoptimering och experiment kommer att utvecklas i framtiden. Kajsa går bland annat igenom hur experimentprocessen ser ut och vilka huvudsakliga steg den består av. Samt vilka olika typer av test och metoder det finns för att genomföra experiment och hur man även kan se det utifrån hur användaren upplever testet. Du får dessutom höra om: Hur man kan optimera mot olika typer av mål Vilken roll experiment fyller i målstyrning och beslut Vanliga missförstånd och misstag med experiment Exempel på ett antal bra experiment och tester Varför man ska sikta på 30 procent vinnande tester Vad man gör med de förlorande experimenten Och vad man kan göra om man har mindre trafik Plus en massa mer om experiment… Kajsa delar även vad hon anser krävs för att bli riktigt bra på experiment och konverteringsoptimering. Samt hur värdefullt ett experimentbaserat mindset faktiskt är. Du hittar som vanligt länkar till allt vi nämnde här i poddinlägget. För dig som vill fördjupa dig ytterligare inom experiment och experimentdesign så har Karin även samlat ihop ett gäng bra länkar till både böcker, artiklar och poddar. Och självklart till kalkylatorn vi pratade om. Efter länkarna hittar du även tidsstämplar till olika sektioner i avsnittet. Länkar Kajsa Hedqvist på LinkedIn Conversionista webbsida Conversionista på LinkedIn Conversion Manager (utbildning) Trafikkalkylatorn samt andra verktyg och mallar från Conversionista (resurser) A/B-testa utan utvecklingshjälp - Conversionista (artikel) 4 sätt att optimera en sajt med lite trafik - Conversionista (artikel) 3 saker att A/B-testa om du ännu inte börjat - Conversionista (artikel) CXL Blog - CRO & Testing (blogg/kategorisida) How to Win with Peep Laja (podcast) Apple Podcasts / Spotify Analytics Toolkit Blog (blogg) You should test that av Chris Goward (bok) Adlibris / Bokus A/B-testing av Dan Siroker / Pete Koomen (bok) Adlibris / Bokus Don't make me think av Steve Krug (bok) Adlibris / Bokus Tidsstämplar [3:41] Kajsa förklarar vad ett experiment är och varför det är så viktigt för att lyckas idag. Och vanliga missförstånd kring experiment och hur de används. [6:51] Om hur man använder konvertingsoptimering och experiment för att optimera mot andra typer av mål än slutkonvertering och köp. Och vad det finns för olika mål man kan testa mot. [11:11] Kajsa om hur det fortfarande är relativt få företag som har en bra process och ex...

Quanto tempo da sua rotina você dedica para tentar entender como está sendo a experiência dos usuários dos seus serviços? São poucos os que fazem esse exercício, apesar do grande valor que ele tem. Como está sendo a interação do juiz com as suas petições? Quais emoções você desperta nas pessoas que lêem os contratos que você cria? Qual imagem o seu cliente tem do seu escritório? Neste episódio, vamos conversar com o Manoel Barbosa sobre a importância que a User Experience (UX) tem para o direito e como podemos utilizá-la de maneira concreta. Ele é designer e comunicador, formado em Publicidade e Propaganda com especialização em UX Design e Agilidade pela PUC Minas. Já participou e liderou projetos de Legal Design para grandes empresas do país e atualmente é Head de Projetos de Legal Design e Visual Law no Fcmlaw. - DIREITO 4.0 PODCAST - Instagram: https://www.instagram.com/direito4.0podcast LinkedIn: https://www.linkedin.com/company/direito-4-0-podcast E-mail: podcast@floox.com.br - MANOEL BARBOSA - LinkedIn: https://www.linkedin.com/in/manoel-barbosa/ Instagram: https://www.instagram.com/manoeu_/ - NOTAS DO EPISÓDIO - LIVROS O Design do Dia a Dia, Donald A. Norman: https://www.amazon.com.br/Design-do-Dia/dp/8532520839/ref=sr_1_1?adgrpid=124700506937&gclid=Cj0KCQjw7KqZBhCBARIsAI-fTKI51GCUF6f9IF1PmgvHhmEDNd0FibtHIgwrXcZkoavK6-Kvqt__gEAaAoD5EALw_wcB&hvadid=593184214549&hvdev=c&hvlocphy=1031849&hvnetw=g&hvqmt=e&hvrand=3191199730788679265&hvtargid=kwd-336057298267&hydadcr=17127_13443086&keywords=o+design+do+dia+a+dia&qid=1663788858&sr=8-1 Design Emocional, Donald A. Norman: https://www.amazon.com.br/Design-Emocional-Donald-Norman/dp/8532523323 Não Me Faça Pensar, Steve Krug: https://www.amazon.com.br/N%C3%A3o-fa%C3%A7a-pensar-Steve-Krug/dp/8576088509/ref=sr_1_1?adgrpid=128695999618&gclid= Cj0KCQjw7KqZBhCBARIsAI-fTKKULaFLXmnsVdsxLV34xHx0txI1bqtJo_9oXW4jYCLd7AYMJ2DXTH8aAklHEALw_wcB&hvadid=593252431430&hvdev=c&hvlocphy=1031849&hvnetw=g&hvqmt=b&hvrand=17691790387546045177&hvtargid=kwd-460057667193&hydadcr=25901_13512671&keywords=n%C3%A3o+me+fa%C3%A7a+pensar+livro&qid=1663789053&sr=8-1&ufe=app_do%3Aamzn1. fos.6d798eae-cadf-45de-946a-f477d47705b9 Storytelling com Dados: Um Guia Sobre Visualização de Dados para Profissionais de Negócios, Cole Nussbaumer Knaflic: https://www.amazon.com.br/Storytelling-com-Dados-Visualiza%C3%A7%C3%A3o-Profissionais/dp/8550804681/ref=sr_1_1?adgrpid=135439436868&gclid=Cj0KCQjw7KqZBhCBARIsAI-fTKKTtVppidTs9wNYuoBarxc0nan0dj1zXzCPaCR4tn4Qd4tcFhSxHT4aAmL5EALw_wcB&hvadid=543992809178&hvdev=c&hvlocphy=1031849&hvnetw=g&hvqmt=e&hvrand=3054655466694055180&hvtargid=kwd-1465700715077&hydadcr=29180_14464368&keywords=storytelling+com+dados+cole+nussbaumer+knaflic&qid=1663789163&sr=8-1 Fundamentos do UX, Guilherme Reis: https://fundamentosdeux.com/ Leis da Psicologia Aplicadas a UX: Usando Psicologia Para Projetar Produtos e Serviços Melhores, Jon Yablonski: https://www.amazon.com.br/Leis-Psicologia-Aplicadas-UX-Projetar/dp/6586057256/ref=sr_1_1?qid=1663789489&refinements=p_27%3AJon+Yablonski&s=books&sr=1-1&text=Jon+Yablonski

Van bezoekers naar boekers. Zo luidt het credo van onze gast van vandaag: Martin van Kranenburg. Met inmiddels bijna vijfentwintig jaar ervaring in het online conversie-spel en de titel 'Beeckestijn Business School docent van het jaar', is Martin zeker geen onbekende in de online marketing wereld.Als je het brein begrijpt kun je het beïnvloeden. Samen met Martin praten we in deze aflevering daarom over: waarom bedrijven steevast business mislopen doordat ze te weinig (of nog nooit) de website-teksten hebben aangepast. Bedrijven die een website maken waar de directeur zich thuisvoelt, maar niet de klant en hoe je met slechts 1 keer per maand door alleen de teksten op je website aan te passen, je conversies kunnen verdubbelen.Shownotes:Denk Podcast: https://www.denkproducties.nl/podcastDon't make me think van Steve Krug: https://www.amazon.nl/Dont-Make-Me-Think-Usability/dp/0321965515Influence van Robert Cialdini: https://www.amazon.nl/Influence-New-Expanded-Psychology-Persuasion/dp/0062937650/

Steve Krug is a UX consultant with 25 years of experience, who has worked with such tech giants as Apple, Bloomberg, Lexus, and NPR. You may also know Steve as the author of “Don't Make Me Think”, one of the best books on usability and UX design for digital products. You will hear about his vision and valuable insights on developing a digital product. Steve stumbled through a couple of careers, before ending up in UI / UX design and usability. Steve's book “Don't Make Me Think”, first published in 2000, is consistently in the top five books recommended for UI/UX designers. Now Steve returns with a fresh perspective to reexamine the principles that made his book a classic, with updated examples and a new chapter on mobile usability.

Warning: This episode might sound intimidating at first but I guarantee a lot of learnings. The focus of the topic has something to do with what it looks like to sell or supply in the EU and the purpose is mainly to share solutions to possible problems your business is facing and get to focus more on scaling the business. I have her with me, Avask Group partner Dr. Angelos Katsaris and Piero Perera to give us glimpse of taxes and costs seller would need to register in order to sell in the EU. In This Episode: [00:30] Avask group on the show with Dr. Angelos Katsaris and Piero Perera. [01:45] A little background of Dr. Angelos and Pier and what are their positions at Avask and the rewarding part of their jobs. [06:17] What is Avask group? [10:56] VAT, OSS and IOSS means? [12:10] What does it look like to sell in the EU, cost and taxes. [16:40] Where does OSS come in? [22:40] VAT registration and requirements. [27:18] US based supplier who wants to sell in the EU. [29:35] The biggest marketplace in the EU. [32:50] Market research. [34:50] What does the process look like working with Avask?   Guest Links and References: Website: https://www.avaskgroup.com/ LinkedIn: https://www.linkedin.com/in/dr-angelos-katsaris-705b1550/ https://www.linkedin.com/in/piero-perera-21525bb0/ Book References: The Online Hustle by     Dr. Angelos Katsaris & Melanie V. Shabangu           Don't Make me Think by Steve Krug   Links and References: Wizards of Amazon: https://www.wizardsofecom.com/ Wizards of Amazon Courses: https://wizardsofamazon.mykajabi.com/a/27566/x6Kwkz6p Wizards of Amazon Meetup: https://www.meetup.com/South-Florida-FBA/ Wizards of Amazon on Facebook: https://www.facebook.com/groups/WizardsofAmazon/ Wizards of Amazon on Instagram: https://www.instagram.com/wizardsofecom/

REVISITING EPISODE 018:   Steve Krug is one of the founding fathers of User Experience and Usability Design, and a bestselling author of two foundational classics in the field: Don't Make Me Think, his guide to Usability Design with over 600,000 copies in print today, and Rocket Surgery Made Easy, a friendly guide to Usability Testing. He based his writing on decades spent as a usability consultant for a wide variety of clients like Apple, Bloomberg.com, Lexus.com, NPR, and the International Monetary Fund, and continues to consult through his firm, Advanced Common Sense.    EPISODE SUMMARY   In this conversation we discuss: [2:45] Life during the Covid pandemic. [5:49] Being nice is better than being smart. [9:04] Being nice in politics. [12:58] Not replacing Mr. Wizard. [17:22] From writing to usability. [22:29] The story behind "Don't Make Me Think". [27:47] Steve's literary style. [31:55] The evolution of UX design. [37:33] Empathy as a pre-requisite for being a great UX expert. [46:28] Writing and hating it since 1980 - about the new book about writing. [52:44] Advice for writers. [55:42] A short sermon on UX.    EPISODE LINKS Steve's Links

My friend Rochelle Dallas, a business transformation coach, online business mentor and Managing Director of Course You Can, explains why you are not going to come into the online space and suddenly wake up as a millionaire. While it certainly is not impossible, it doesn't happen without laying some strong business foundations first.  What You Will Learn In This Episode: - Where the motivation to get your message out there comes from - The little steps in between a freebie and a high ticket - Having a self-study program is a great way of bottling up your knowledge and selling it - The number one tip for clients' onboarding process - Why clients need to be able to independently move through their own transformation and build their own courses even if you are not near - How we can package up our own personal knowledge that then has a wider impact   There are massive opportunities now for semi-passive, recurring income if you create a course, but not all courses are done well. Make sure that ayour clients are informed and are looked after from the moment they onboard. Think about all the people that are missing the deep understanding and the deep development work that you can give them, and get all the elements in your business right. Resources: - Get hold of Rochelle's three scorecards at www.ofcourseyoucan.co.uk - Rochelle Dallas website https://www.rochelledallas.com/  - Don't Make Me Think, a book by Steve Krug https://amzn.to/3RinVtz  - Check out our Legendary Podcast Launch Package at www.annapn.co/launch - My website https://www.annaparkernaples.co.uk - Find me on Facebook: https://www.facebook.com/AnnaParkerNaplesCoach - Find me on Instagram: https://www.instagram.com/annaparkernaples  - Podcast Sales Funnel http://www.annapn.co/funnel 

Today, I am joined with usability consultant Steve Krug. Steve is the author of Don't Make Me Think, the most recommended book for anyone who wants to learn about user experience (UX), and Rocket Surgery Made Easy, a usability testing handbook. His books were based on the 25+ years he spent as a usability consultant for various clients like Apple, Bloomberg.com, Lexus.com, NPR, and the International Monetary Fund. Tune in! The show notes, including the transcript and checklist to this episode, are at marketingspeak.com/349. 

Steve Krug is the author of the book Don't Make Me Think. He's rewritten the book three times, and so far, it's sold over 600,000 copies. During the interview, I got into why he decided to rewrite the book several times and how the book helped him build a business around writing technical non-fiction for his audience. Steve also talks to me about what he's up to these days and gives some valuable tips for overcoming the creative process and problems in the creative process like procrastination and writer's block. Listening to Steve is reassuring as it shows that writers of all levels have issues with procrastination and motivation. Steve also talks about some of the books that have significantly influenced him.In this episode, we discuss:The best approach for setting up a new website todayHow Steve came to write his bookWhat Steve is writing todayUsing the Getting Things Done methodology How procrastination has been an ongoing problem for SteveResources:Don't Make Me ThinkSensibleGetting Things DoneSteve on TwitterSupport the show

Lucas est Head of Design chez Agorapulse. Passionné de dessin depuis son plus jeune âge, à la fin du lycée Lucas aimerait continuer dans cette voie, mais pense qu'il n'a pas le niveau pour aller dans une école d'art et en faire son métier. Lucas s'orient alors dans la sociologie et l'ethnologie. Après 2 ans, il se réoriente dans la communication et la publicité. Il y découvre Photoshop et s'oriente vers le graphisme et la direction artistique après une multitude de stages. A la fin de ses études, il rejoint Publicis en tant que chef de projet afin, à terme, d'y faire de la créa. Néanmoins, il se rend vite compte que la création en agence publicitaire n'est pas aligné avec ses valeurs et sa volonté d'aider les utilisateurs. Il passe par d'autres agences de publicité, plus petites, et des agences de freelances. Après ces différentes expériences, Lucas se lance dans le freelance à temps plein. Dans un premier temps, il fait de tout : print, illustration, DA, branding et webdesign. Après avoir touché à tout, Lucas décide d'apprendre l'UX Design. Lucas décide également de voyager de devenir freelance en itinérance depuis l'Australie, la Corée du Sud, l'Indonésie et la Nouvelle-Zélande. L'occasion de parler de la relation avec ses clients français à l'époque, de la recherche de nouveaux clients dans des pays qu'il ne connait pas, des différentes mentalités vis-à-vis du Product Design et de son rôle et ses missions. Lorsque Lucas revient en France, il est contacté par le Boston Consulting Group pour travailler dans le start-up studio de Renault : Renault Digital. Il travaille sur quelques projets qui n'aboutissent pas, avant de travailler, pendant 2 ans, sur le dashboard de la performance et de l'analyse de l'entreprise. Lucas revient sur ce projet qui concerne un grand nombre d'entités et d'équipes du groupe Renault réparties sur une vingtaine de pays. Il nous parle de la genèse du projet, des étapes par lesquelles il est passé pour créer 4 itérations du produit, sa relation avec les Product Managers et les développeurs, sa relation avec la direction de Renault, les méthodologies suivies et mises en place, etc. Lucas a toujours travaillé en tant que freelance, mais après 10 ans, il rejoint Agorapulse en tant que salarié afin d'y créer l'équipe Design. Il doit d'abord tout remettre en place : création d'une direction artistique, mise en place d'un Design System, remise à plat des process entre les équipes et l'évangélisation du métier. Vu à son arrivée comme le “peintre” de l'équipe, Lucas doit expliquer son métier en amenant de nouvelles méthodes de travail. Il revient sur les techniques et méthodes mises en place pour expliquer et démocratiser son métier auprès des employés d'Agorapulse. Au début, Lucas mène de front l'ensemble des sujets avec une Product Designer Junior. Rapidement, la nécessité de faire grandir l'équipe Design se fait sentir pour gérer l'ensemble des features. Il va alors recruter des UI Designers, avec une appétence UX, pour gérer les évolutions rapides du quotidien. Néanmoins, recruter des profils juniors fait ralentir la cadence, car il faut davantage les accompagner et les faire monter en compétences. Lucas revient sur ces profils qu'il a recruter, les avantages et les désavantages que cela a eu sur sa charge de travail et comment il a modifié ses méthodes de recrutement dans un contexte d'hypercroissance. L'équipe Design d'Agorapulse est passée de 2 à 6 personnes en 1 an. Pour s'assurer que tout fonctionne bien, Lucas a mis en place un certain nombre de rituels qu'il nous partage : Weekly Work Overview Design Critiques Design Retrospective Design System Workshop Design Fiction Figma Clean-up UX Research Day UX/UI Level-up On parle également du rôle de la recherche utilisateur quand on opère sur 14 pays différents et de la relation avec le service client et les commerciaux pour obtenir leurs retours. Aussi, aborde-t-on la place du tone of voice et de sa place dans le produit. Et enfin, on parle du rôle des Brand Designers freelances dans l'entreprises, des raisons de faire appel à eux, mais également des problèmes que cela peut apporter en terme de consistence dans le temps. Les ressources de l'épisodes Agorapulse WTTJ Agorapulse Le site de Lucas Dovetail Harvstr Slite Methodes de Design UX, Carine Lallemand The Design of Everyday Things, Don Norman It's not you. Doors are bad everywhere Hooked, Nir Eyal Lean UX, Jeff Gothelf Profession Graphiste Indépendant, Julien Maya & Eric Delamarre Rocket Surgery Made Easy, Steve Krug  Just Enough Research, Erika Hall Ruined by Design, Mike Monteiro Nielsen Norman Group Les autres épisodes de Design Journeys L'épisode #3 avec Romain Briaux, Designer 3D @ Hervé Studio L'épisode #4 avec Loïc Guay, Head of Design @ Malt Pour contacter Lucas : LinkedIn Instagram  Pour soutenir le podcast, n'hésite pas à mettre ⭐️⭐️⭐️⭐️⭐️ sur Apple Podcast ou Spotify pour aider les autres designers à découvrir le podcast 

No Attri.zip de hoje, o Gerente de Projetos Rodrigo Ribaldo fala sobre sua experiência com projetos de tecnologia e os principais desafios que se apresentam nesse modelo de gestão, principalmente quando lidamos com empresas mais tradicionais, além de diversas dicas que ajudam a conduzir projetos de tecnologia com ainda mais resultados. Livro indicado no episódio: Não me faça pensar - Steve Krug - https://amzn.to/3GGimyr --- Send in a voice message: https://anchor.fm/attritec/message

Adam Lovallo LinkedIn - https://www.linkedin.com/in/adamlovallo/Thesis Testing - https://www.thesistesting.com/Nik Sharma - https://www.linkedin.com/in/mrniksharmaThe No Asshole Rule a book by Robert I. SuttonThe Great Game of Business a book by Bo Burlingham and Jack StackDon't Make Me Think a book by Steve Krug

Hoe pas je de invloeden van Cialdini nu goed toe in jouw marketing? In deze aflevering is Daan Schmidt in gesprek met Martin van Kranenburg, specialist op het gebied van conversie en neuromarketing, trainer, spreker en schrijver van de whitepaper online beïnvloeden waarin hij de principes van Cialdini heeft vertaald naar de online omgeving.De rode draad binnen conversie volgens Martin is het spel van hoe maak je van zoekers boekers en zorg je dat mensen superblij worden. Een bezoeker heeft een doel en dit doel wil hij op jouw website halen. Het fundament volgens het StoryBrand script moet staan en dan kun je met het model van Martin verder optimaliseren. Beluister de formules van Martin in combinatie  met de 7 beïnvloedingsinstrumenten van Robert Cialdini:schaarstesociale bewijskrachtautoriteitsympathiewederkerigheidcommitment en consistentieeenheidEen veel gehoorde opmerking is dat de invloeden van Robert Cialdini wel bekend zijn. Het gaat er niet om wat je weet maar wat je er uiteindelijk mee doet. Ga met de kennis uit deze aflevering aan de slag zodat jij ook bezoekers hebt die superblij worden.Als het om boeken gaat geeft Martin aan dat je een goed boek kiest over een onderwerp waar je beter in wil worden. Hij noemt het boek:Steve Krug, don't make me think en natuurlijk mag het nieuwe boek van Robert Cialdini, Invloed niet ontbrekenMeer informatie over Martin van Kranenburg vind je hierWil jij naar aanleiding van deze podcast aan de slag met een heldere boodschap, schrijf je dan nu in voor de 2-daagse workshops StoryBrand op: https://storybrand.nl

There are a couple of important points for website owners to keep in mind when creating the Call-to-Action. This “CTA” is what leads visitors to take action and reach out to you. For “lead generation” websites, the CTA marks the end of the Marketing Journey and the beginning of the Sales Journey. This episode covers the mistakes that I see most often and the simple steps you can take to avoid them. IN THIS EPISODE…[02:54] You can now support our show! [07:52] What's in for you in today's episode [08:40] Why did google eliminate matching of keywords in domain names [10:07] Why buy domain variations of your business name [11:49] Why I use Google Domains to buy domain names [13:06] Don't use generic CTAs [14:34] Your CTA is the most important button on your site [16:43] Don't offer multiple CTAs [17:50] Why landing pages convert better than websites [20:48] Don't make your users think! [25:08] In summaryMEREDITH'S HUSBAND SAYS …“CTAs are the most important part of your website. They're the reason your site exists!” “The CTA is typically the biggest button on any web page.” “The Call-to-Action is the end of the marketing journey and the beginning of the sales journey.” LINKS TO RESOURCES MENTIONED...Google Domains: https://domains.google Don't Make Me Think [book, by Steve Krug] https://amzn.to/3IKUM5Y CONNECT WITH US ...Web: https://www.thewebinaut.com/merediths-husband/ Instagram: https://www.instagram.com/meredithshusband/  

Waarschuwing! Deze podcast gaat op turbotempo. Onze gast Martin van Kranenburg heeft er zin in en wil zoveel mogelijk inzichten delen. Dat levert een zeer snelle en rijk gevulde aflevering op, over ‘schrijven voor het brein':Wat moet je doen om de lezers van je website, je mail of je offerte sneller ja te laten zeggen? Welke schrijftips maken je teksten sterker, overtuigender en sympathieker?Wat kun je concreet met de inzichten van psychologen als Cialdini, BJ Fogg of neuromarketeers Siegfried Vögele en Steve Krug?Remy Gieling en Hans Janssen probeerden Martin bij te houden. Dat lukte best vaak. Gelukkig maakten ze notities en met deze shownotes kun je de diepte in op onderwerpen die voorbijkwamen:Martin van Kranenburg: https://www.linkedin.com/in/martinvankranenburgSchrijven voor het Brein: https://schrijvenvoorhetbrein.nlSchrijven voor het brein: Het werk van Siegfried Vögele -  Dialoogmethode: https://schrijvenvoorhetbrein.nl/de-dialoogmethodeSteve Krug: don't make me think (voor websitebouwers): https://www.consumpsy.nl/blog/2013/inzichten-dont-make-me-thinkDownload de Cialdini powerwords: https://schrijvenvoorhetbrein.nl/cialdini-powerwordsWhitepaper Online Beïnvloeden: https://onlinebeinvloeden.nlHoe overtuig je langzame lezers: https://www.marketingfacts.nl/berichten/het-beinvloeden-van-archetypes-met-cialdinis-techniekenOver het werk van BJ Fogg, de Hobson +1 en vele andere technieken: https://imu.nl/conversie-verhogen-martin-kranenburgIn een limousine naar de bedank pagina: https://www.thuiswinkel.org/webshops/nieuws/martin-van-kranenburg-rijd-je-bezoeker-in-een-limousine-naar-de-bedankpaginaMartin was de best beoordeelde spreker op de Webwinkel Vakdagen -hét event over online shoppen- met deze presentatie: https://www.youtube.com/watch?v=unQJ0rSj1roEn Oh ja: Martin figureerde met zijn zoon ook nog in de videoclip van Snelle en Thomas Acda: Papa heeft weer wat gelezen: https://www.youtube.com/watch?v=d1Rh80xM7_8 

How does psychology relate to business? What insights can we use from behavioural science to improve customer experience and even boost sales?Roger Dooley, international keynote speaker, writer, author, and founder of Dooley Directs consultancy, shares his expert knowledge about the intriguing relationship between science and business. He highlights research-backed tactics that any marketers or business owner can use to grow their business and connect with consumers.Roger became fascinated with the convergence in neuroscience and marketing, then began writing about the buzzworthy concept of using behavioural science in your marketing strategy.Since 2006, his work in persuasion, friction, and influence has created a powerful ripple of impact in the digital marketing community.Listen in to learn how Robert and other marketing professionals in companies of all sizes are optimizing their marketing strategies and reducing friction by researching and implementing behavioural science principles. Key Takeaways Savvy brands with large marketing budgets are focusing on leveraging behavioural science principles, like scarcity, social proof, and authority to increase marketing efficacy and sales.In the last 10-20 years, many more brands have adopted behavioural science tactics to create better HR outcomes within the company, improve conversion on their website, improve sales and distribution channels, and much more.Whether you're a large company or a small business, it's very important to test these behavioural science concepts.Roger's one message to marketing professionals and business owners is that consumers and customers are non-consciously influenced to a degree that many businesses don't understand. There are great benefits to eliminating friction, or any unnecessary effort to perform a task, in your business. Doing this will result in a more highly-rated customer experience, but it needs to be a business decision which you get buy-in on.To identify friction in your small business, ask customers to rate/review your processes and the effort spent in those processes. Empathy, care, and connectedness are essential parts of building trust with customers. Demonstrating empathy at scale, even in chat bots, has become a crucial tactic for online businesses.Focus on building a team that is invested in improving customer experience and creating an effortless experience for customers. In addition to that, work to reduce friction for your employees, so it's easier for them to provide great service to your customers.Resources Mentioned:Brainfluence by Roger Dooley: www.rogerdooley.com/books/brainfluence Thinking Fast and Slow by Daniel Kahneman: https://amzn.to/3Ce85rWInfluence by Robert Cialdini: https://amzn.to/3GidBMFPredictably Irrational by Dan Ariely: https://amzn.to/2XKL5SnDon't Make Me Think by Steve Krug: https://amzn.to/2XInIsrSmall DATA by Martin Lindstrom: https://amzn.to/2XIslTlMost Recent Forbes Article - HereGet connected with Roger:Visit his website: www.rogerdooley.com Connect with him on LinkedIn: www.linkedin.com/in/dooley Follow him on Twitter: www.twitter.com/rogerdooley 

Bonjour et bienvenue dans Du Vent Sous La Robe, le podcast qui vous emmène à la rencontre d'acteurs innovants qui construisent le droit de demain. Pour cette trente-et-unième interview, j'accueille Alassane Samb, Camille Sztejnhorn et Mathieu Bouillon. Le point commun entre ces trois personnes ? La création d'Oppus x Lefebvre Dalloz, un outil qui permet de simplifier la rédaction des contrats de travail et autres documents RH, et de vérifier, en temps réel, la conformité des données saisies avec la loi et les conventions collectives. Oppus, c'est l'histoire de la rencontre de trois étudiants tout droit sortis des bancs de la fac, Alassane Samb, Vincent Ferreira et Hugo Menzaghi avec un grand groupe: Lefebvre Dalloz, grâce au partenariat noué par le groupe avec l'association Matrice et l'école 42. Mais c'est surtout l'histoire d'une collaboration entre Alassane, juriste de formation, et son équipe, Camille, directrice de l'innovation du groupe Lefebvre Sarrut et Mathieu, serial entrepreneur, coach du projet et responsable de l'accélérateur de start-up LightSpeed créé par le groupe. Avec Alassane, Camille et Mathieu, on a parlé : - De l'outil qu'ils ont développé et de comment il fonctionne ;  - De comment on construit un projet d'innovation dans le domaine du droit ;  - Des clés de succès et des erreurs à ne pas commettre ;  - De l'intérêt pour un grand groupe et une start-up de collaborer ensemble pour créer un outil innovant ;  - De l'accélérateur de start-up LightSpeed créé par le groupe Lefebvre Sarrut ;  - Mais aussi de la nécessité de s'inspirer de ce qui existe en dehors du droit ;  - Et de comment penser l'expérience utilisateur pour rendre les outils les plus simples et efficaces possibles. Plein de conseils et de retours d'expérience hyper intéressants dans cet épisode, alors tous à vos écouteurs !     Pour aller plus loin : - Oppus X Lefebvre Dalloz ;  - Tomorrow's Lawyers: An Introduction to Your Future de Richard Susskind ;  - Matrice ;  - Ecole 42 ;  - Don't make me think de Steve Krug ;  - Site regroupant différentes ressources sur l'apprentissage du design ;   - The Lean Startup d'Eric Ries ;  - Innovation stories ;  - Le Lab d' innovation de Lefebvre Sarrut ;   - L'accélérateur de start-up Lightspeed;   - Le podcast Planche mixte de Mathieu sur la musique ;  - Life is life d'Opus ; - Sarà perchè ti amo de Ricchi e poveri ; - Lil Nas X ;  - Good vibrations de Marky Mark and the funky bunch.  

Don't Make Me Think is a book by Steve Krug about human-computer interaction and web usability. The book's premise is that a good software program or website should let users accomplish their intended tasks as easily and directly as possible. Tune in NOW to know more!

Today's Marketer has a complex job. We have to figure out how to deliver on the functional elements of Marketing while using all of the Marketing Tech tools at our disposal. At the same time, we must stay in touch with the emotional and relational aspects that really make consumers take action.And within that, we have a social element. How do we inject our marketing into the conversations that our consumers have with each other?And finally, we have to align “our” systems of thinking to fit with the thinking and journeys of our consumers!Joining me on the podcast today is the Vice President of community impact for Jackson Healthcare, where he helps leverage people, programming, partnerships and philanthropy to improve access to healthcare and the wellbeing of young people.As a writer, he helps professionals cultivate a deeper understanding of who they are and why they do the work they do — their values and purpose. I discovered his solid advice to Marketing and Business Professionals through his articles on BusinessGrow.com and am delighted to welcome as a guest on the podcast -  Keith Jennings!Conversation points:Keith, you have an article on BusinessGrow.com that I really like. In that article - You say that "Businesses hire marketing to do a variety of jobs - such as brand awareness, lead generation, SEO,  and more. But you explain that these jobs aren't limited to their functional elements. They come with a mix of FUNCTIONAL, EMOTIONAL, RELATIONAL, AND SPIRITUAL, elements. Can you walk us through those jobs of Marketing beyond the FUNCTIONAL jobs that we are accustomed to marketing delivering? As a content production agency owner, in order to make absolutely sure that we can deliver on client expectations, the first question that we ask a prospect is – “What do you want this content to do?” or “What do you want this video or podcast to do for your business?” So, What are some other tips you can provide to help marketers and their execs – as well as marketers and their agencies better align their expectations? I want to pivot a bit to how consumers communicate to each other about our brands. And, I want to introduce the audience to a term that I learned from you. That term that I believe dates back to about 2007 maybe when Jyri Engestrom mentioned it -  The term is “Social Objects."Before we discuss the term “Social Objects," Please share your definition of Social Objects with us. How can Marketers create and utilize social objects for their brands? (Some examples?)  Keith, I want to talk about a common Marketing mistake that you recently wrote about on LinkedIn. One of the great things about talking with interesting people like you, Keith, is that I get to benefit from books that you've read – that I haven't. You referenced a Daniel Kahneman book entitled “Thinking Fast and Slow." In his book he dives into System 1 and System 2 thinking. You parallel this type of thinking in your LinkedIn article to demonstrate an avoidable “Marketing Mistake All Businesses Make." So maybe we should define these systems of thinking for our audience first. How are marketers subject to System 1 and System 2 thinking and how can System one thinking be a mistake? As a Marketer, I've always operated by Steve Krug's “Don't Make Me Think” approach by not making the content consumer think more than they need to in order to receive a message. So in that light, does System 1 Thinking still have its place in Marketing? Thanks to the listeners. If you're listening to the podcast and want to also “see” Keith and I,  - video of this podcast and OTHERS are available in the podcast section of ContentMonsta.com.This podcast is produced by Content Monsta - A leading producer of B2B Content.

Business Book Movement. Revisión del libro: No me hagas pensarAutor: Steve KrugInvitada: Cecilia UrionaApoya este podcast y súmate a la comunidad de bookers en Patreonhttps://bookmovement.co/patreonÚnete a nuestra comunidad en Discord a través del siguiente enlace:https://bookmovement.co/discordObserva nuestras transmisiones en vivo a través de nustro canal de Youtubehttps://bookmovement.co/youtube See acast.com/privacy for privacy and opt-out information.

My guest today leads loyalty initiatives for one of the biggest banks in South Africa - Nedbank, whose Greenbacks Loyalty Programme began as a simple card swipe incentive programme, but has evolved as a powerful way for the bank to reward its complete banking relationships with their customers. By listening to customer feedback and understanding loyalty psychology and behavioural economics, Dharmesh Bhana is leading the evolution of a compelling loyalty proposition, focused on benefitting all stakeholders. Whether it's to help customers manage their money better, reward responsible borrowing or build excitement and engagement at key moments in customer's lives, Dharmesh shares his favourite learnings, including the power of competitions as a loyalty mechanic, as well as tangible rewards that can be converted in to cash to be easily used by customers. Show Notes: 1) Dharmesh Bhana - Executive: Loyalty & Rewards 2) Nedbank 3) Book Recommendation: "Don't Make Me Think" by Steve Krug

Auf euren Wunsch hin diskutieren wir heute über unsere Suchtipps - ganz allgemein, aus dem Studium und zu den Themen Customer und User Experience. Wir freuen uns schon mega auf eure Suchtipps auf LinkedIn und werden diese Liste hier Stück für Stück mit euren Tipps erweitern. Also die Frage an euch: Was sind eure Suchtipps ? Vielen lieben Dank fürs reinhören und bis zum nächste Mal. Sebastian und Lukas CXEinfachMachen: www.cxeinfachmachen.de Sebastian: https://www.linkedin.com/in/sebastian-syperek-57b6aa19/ Lukas: https://www.linkedin.com/in/lukas-kauderer-a18473112/ CX fit Academy: https://www.cx-fit.com Buchempfehlungen: Sebastian:https://www.amazon.de/Statistik-Human-Sozialwissenschaftler-Sonderausgabe-Springer-Lehrbuch/dp/3662503735/ref=sr_1_1?adgrpid=71483615032&dchild=1&gclid=Cj0KCQjwlMaGBhD3ARIsAPvWd6jMku-8SsrdQ_KdMIfvVx4wwY_vprWNozQjU5MYR2P7XP2UeBO76NIaAlB0EALw_wcB&hvadid=353054943525&hvdev=c&hvlocphy=9044381&hvnetw=g&hvqmt=e&hvrand=15684249411243442899&hvtargid=kwd-298816414462&hydadcr=24126_1739946&keywords=bortz+statistik&qid=1624371682&sr=8-1https://www.amazon.de/-/en/Philip-Kotler/dp/379101689Xhttps://www.amazon.de/-/en/Steve-Krug/dp/3826697057/ref=sr_1_2?crid=10361XOEON8FA&dchild=1&keywords=dont+make+me+think&qid=1624371798&s=books&sprefix=dont+make%2Cstripbooks%2C179&sr=1-2https://www.amazon.de/-/en/Ultimate-Question-Promoter-Business-Thrive/dp/1422173356/ref=sr_1_1?dchild=1&keywords=fred+reichheld&qid=1624371818&s=books&sr=1-1https://www.amazon.de/-/en/James-Clear/dp/1847941834/ref=sr_1_1?crid=3IT548XQUS7LM&dchild=1&keywords=atomic+habits+deutsch&qid=1624371851&s=books&sprefix=atomic+ha%2Cstripbooks%2C184&sr=1-1https://www.amazon.de/-/en/Robert-T-Kiyosaki/dp/1612680194/ref=sr_1_1?crid=3SR1QOQTH3HHN&dchild=1&keywords=rich+dad+poor+dad&qid=1624371885&s=books&sprefix=rich+dad+p%2Cstripbooks%2C172&sr=1-1https://www.amazon.de/-/en/Timothy-Ferriss/dp/1785041274/ref=sr_1_1?dchild=1&keywords=tim+ferriss+tools+of+titans&qid=1624371950&s=books&sr=1-1https://www.amazon.de/-/en/Tomer-Sharon/dp/1933820292/ref=sr_1_1?dchild=1&keywords=tomer+sharon+validating+product+ideas&qid=1624372266&s=books&sr=1-1https://www.interaction-design.org/https://skillshare.comLukasKunden begeistern mit System: https://www.amazon.de/dp/3593509954/ref=cm_sw_em_r_mt_dp_CV2HDCQMDD8Y16V6BQ14INSPIRED: How to Create Tech Products Customers Love: https://www.amazon.de/dp/1119387507/ref=cm_sw_em_r_mt_dp_R8Z0BG7F74Y8086H5TCGElon Musk: Wie Elon Musk die Welt verändert: https://www.amazon.de/dp/3898799069/ref=cm_sw_em_r_mt_dp_KY32PT53VJGXCVDQPAJXLean Startup: Schnell, risikolos und erfolgreich Unternehmen gründen: https://www.amazon.de/dp/3868815678/ref=cm_sw_em_r_mt_dp_P9JW0E7MFDJ0FF997A3CDer Mom Test: Wie Sie Kunden richtig interviewen und herausfinden, ob Ihre Geschäftsidee gut ist: https://www.amazon.de/dp/1533697256/ref=cm_sw_em_r_mt_dp_APX4QDZJRDEQV6BWS0D7simplify your life: Einfacher und glücklicher leben: https://www.amazon.de/dp/3593394499/ref=cm_sw_em_r_mt_dp_HGYSMSNCFHNPBQMNAP6XDigital Innovation Playbook. Das unverzichtbare Arbeitsbuch für Gründer*innen, Macher*innen und Manager*innen: https://www.amazon.de/dp/3867745560/ref=cm_sw_em_r_mt_dp_RK303MR6XCJ2MK74QYGT CXEinfachMachen - ein Podcast von Lukas Kauderer (CEO liCili) und Sebastian Syperek (Head of Customer Insights - Deutsche Bahn AG) rund um den Bereich der Customer Experience, Marktforschung und dem Produktmanagement. In 30 - 45 Minütigen Podcast-Folgen sprechen die beiden über grundlegenden Themen rund um das Thema Kundenorientierung, zeigen Tools und Methoden des Customer Experience auf und erzählen über Ihre eigenen Erfahrungen.

☕ Episode #076 du #podcast 100% news #ecommerce, #digital et #socialmedia !

As vastly important as DIY usability-testing is, and as simple and straightforward as its processes can be, it's surprisingly unfortunate how tiny a fraction of people actually get it done. Moreover, it doesn't always have to be in-person - remote-testing can get the job done too. All this and more, in this book-review episode, on Rocket Surgery Made Easy, by Steve Krug. Please rate & review this podcast here: https://podcasts.apple.com/in/podcast/the-31-5-guy-podcast/id1528897344 You can find me at https://rounakbose.in Links: https://www.instagram.com/the31point5guy/ https://twitter.com/The31point5Guy https://medium.com/the-31-5-guy https://www.linkedin.com/in/rounakbose1997/ ~ The 31.5 Guy

Steve Krug reflects on 30+ years of contribution to the field of UX, including two best-selling books, in this wide-ranging conversation.   How did Steve's present the findings of his first UX research report?   What is the greatest usability challenge we face as a society? What has Steve realised about procrastination?   Who is Steve Krug?   Steve is a former usability consultant and author of the world-famous UX book, “Don't Make Me Think: A Common Sense Approach to Web (and Mobile) Usability”, which is now in its third edition and has sold over 600,000 copies - in 20 languages. For over 25 years Steve worked as as usability consultant, through his firm Advanced Common Sense, where he helped clients including Apple, Bloomberg, Lexus, NPR, and the International Monetary Fund, to remove friction from experiences.   ======   Find Steve here:   Website: http://stevekrug.com/ Twitter: https://twitter.com/skrug   ======   Thank you for tuning in! If you liked what you saw and want more ...   ... please leave us a review on Apple Podcasts (or wherever you listened).   You can also follow us on our other social channels for more great UX and product design tips, interviews and insights!   LinkedIn: https://www.linkedin.com/company/the-space-in-between/ Instagram: https://www.instagram.com/thespaceinbetw__n/   ======   Host: Brendan Jarvis https://www.linkedin.com/in/brendanjarvis/

Steve Krug, author of Don’t Make Me Think, and Rocket Surgery Made Easy, is back for a third appearance on the Rosenfeld Review Podcast! Here, he shares some details with Lou about his book in the works, Writing Made Slightly Easier, and his perspective on the process of writing in general (and why he might advise against it!). Check our Steve’s previous two appearances: How To Get Usability Testing Right: https://soundcloud.com/rosenfeld-media/how-to-get-usability-testing-right-steve-krug Life with the Apple Watch and other wearables: https://soundcloud.com/rosenfeld-media/conversation-with-steve-krug-life-with-the-apple-watch-and-other-wearables Steve’s wise words for writers: Don’t be afraid to always start at the beginning. Always assume that your reader knows less rather than more. Steve recommends: Follow Laura Klein on Twitter https://twitter.com/lauraklein More about Steve Krug: https://sensible.com/

主持：Hanna Wu & Luke Lo 嘉賓：Remi Yau, Senior Product Designer @Shopee ==== 要教育公司投放資源著重UX並非一件容易的事，如果難以說服管理層著重UX，那你自己就要判斷現在的公司是否適合你繼續發展。而要轉到Design規模較好的公司，入職門檻亦會相對提高，這時你一定努力打好基礎，建立優秀的Portfolio，增強個人競爭力。 大家在求職面試中，要盡量了解公司的Team Size、是否重視Design和不同的Stakeholder 對Design的認知程度，這些都會幫助你判斷公司能否提供足夠的空間和環境給你發揮和成長。 即使未有機會入職上市公司也絕對不是損失，在中小企公司工作，你或者會遇到更多機會嘗試不同的Project和與老閭/客戶直接Pitching的機會，這些經驗對Designer來說也是非常重要的。 這集Remi提到她用過以下的方法學習UX Foundation: 1. Online course: Udemy - User Experience, The ultimate guide to usability. 2. IXDA Mentorship Programme 3. 每日看一篇Medium的article 4. 每日看2-3分鐘Nielsen Norman Group的Video 5. Recommended Books: "UX for Beginners" by Joel Marsh, "Don't make me think" by Steve Krug, "Business thinking for designer" by Design Better ==== PayPal App課金：t.ly/taA6 Telegram: t.me/uxhongkong Instagram: www.instagram.com/10uxhk/ Podcast music by Joakim Karud --- Support this podcast: https://anchor.fm/10ux/support

This episode of the podcast derivates between several topics. It is a lovely conversation with my guest, Pedro Martins. To know more listen to the podcast // If you want to help this podcast, I created a Patreon. All the help is welcome (https://www.patreon.com/steacomedy_philosophy) // Books mentioned links Exposure (by Olivia Sudjic) [https://www.amazon.co.uk/Exposure-Olivia-Sudjic/dp/1999922336] // The Art of Happiness: A Handbook for Living (By Dalai Lama) [https://www.amazon.co.uk/Art-Happiness-Handbook-Living/dp/0340750154/ref=sr_1_1?crid=29A1D9DR5IPFE&dchild=1&keywords=the+art+of+happiness+by+dalai+lama&qid=1605012996&s=books&sprefix=the+art+of+happ%2Cstripbooks%2C163&sr=1-1] // How the Mind Works (by Steven Pinker) [https://www.amazon.co.uk/Mind-Works-Penguin-Press-Science/dp/0140244913/ref=sr_1_1?crid=22VHDRHNYB16A&dchild=1&keywords=how+the+mind+works+steven+pinker&qid=1605013028&s=books&sprefix=how+the+mind+wo%2Cstripbooks%2C157&sr=1-1] // Anxiety for Beginners: A Personal Investigation (by Eleanor Morgan) [https://www.amazon.co.uk/Anxiety-Beginners-Investigation-Eleanor-Morgan/dp/1509813241/ref=sr_1_1?dchild=1&keywords=anxiety+for+beginners&qid=1605013065&s=books&sr=1-1] // Don't Make Me Think, Revisited: A Common Sense Approach to Web Usability (by Steve Krug) [https://www.amazon.co.uk/Dont-Make-Think-Revisited-Usability/dp/0321965515/ref=sr_1_1?crid=3HV12TAHSFMQX&dchild=1&keywords=dont+make+me+think&qid=1605013089&s=books&sprefix=dont+make+me+think%2Cstripbooks%2C164&sr=1-1] // You can enter in contact via email (stea.comedy.philosophy@outlook.pt) // Or even by my social media, Instagram (https://instagram.com/stea_comedy?igshid=5upgor5cwjh2) // Twitter (https://twitter.com/Stea_Comedy?s=09) // Youtube channel (https://www.youtube.com/channel/UClvnLCF-TCnjfMVP-7xa5yQ)

This month we discussed the book "Don't Make Me Think, Revisited: A Common Sense Approach to Web Usability" together with the author Steve Krug and other Product Managers. We all shared our main take aways, and then discussed with Steve about what things have now changed since the last edition of the book was published. When should we try new things compared to use the common conventions, what is different now in mobile and some other interesting topics. About the Product Book Club: Discuss product-related books once a month with new colleagues and the book's author. Join productbookclub.com to know what other books we are reading, and participate in the upcoming discussions! Follow us on Social Media: https://www.linkedin.com/company/productbookclub/ https://www.facebook.com/productbookclub https://instagram.com/productbookclub https://twitter.com/prodbookclub

PEOPLE DON'T READ! But why...? Reading chapter 2 of Steve Krug's "Don't Make Me Think! Revisited"

What is UX? An intro to User Experience (No, UX is not UI)What is User Experience? How is it different from User Interface design? What if all buttons were now alpacas?In this episode, we introduce the field of UX design and some of the basic principles you should know to design and develop great experiences. We discuss the fundamentals of good UX: Usability, accessibility, desirability, findability, credibility, the importance of following established patterns...and when to break the rules.Questions? Email ustheoverlappodcast@gmail.comTweet us @lovelettersco or @mistertrostFor more episodes + show notes, visitoverlappodcast.comResourceshttps://lawsofux.com/https://theblog.adobe.com/15-rules-every-ux-designer-know/https://uxplanet.org/golden-rules-of-user-interface-design-19282aeb06bhttps://www.usability.gov/what-and-why/user-experience.htmlhttps://www.interaction-design.org/literatureAesthetic usability effect: https://www.nngroup.com/articles/aesthetic-usability-effect/Design thinking: https://www.atlassian.com/team-playbook/playsDon't Make Me Think by Steve Krug https://www.amazon.com/Dont-Make-Think-Revisited-Usability/dp/0321965515/

ResourcesFollow-up thread for the episode on RStudio Community{golem} - A Framework for Building Robust Shiny Apps: thinkr-open.github.io/golemThinkR - R Engineering, training, and consulting: thinkr.frBuilding Big Shiny Apps - A Workflow: thinkr-open.github.io/building-shiny-apps-workflowDon't make me think, Steve Krug: en.wikipedia.org/wiki/Don%27t_Make_Me_ThinkThe Design of Everyday things: en.wikipedia.org/wiki/The_Design_of_Everyday_ThingsRefactoring UI: refactoringui.comfreeCodeCamp: learn.freecodecamp.orgWeb Fundamentals - Google's opinionated reference for building amazing web experiences: developers.google.com/web/fundamentalsCorecursive Podcast episode 19 - Test in Production with Charity Majors: corecursive.com/019-test-in-production-with-charity-majorsVisit shinydevseries.com for all previous episodesSign up for the 2019 live webinars in partnership with RStudio Community at pages.rstudio.net/shiny_dev_series.html

A highly sought-after speaker, Steve Krug is a usability consultant who has more than 20 years of experience as a user advocate for companies like Apple, Netscape, AOL, Lexus, and others. He is best known for his book Don't Make Me Think about human-computer interaction and web usability. His second book, Rocket Surgery Made Easy, is a DIY guide for Finding and fixing usability problems.

New to the Club? Missed a few episodes? Or just want to revisit some of the most mind-tingling insights from recent guests? This is the place to start. A few selected highlights from episodes 31-39, including: Bec Evans of WriteTrack on establishing your writing habit (may or may not involve champagne) Productivity Ninja Grace Marshall on why procrastination is an inevitable part of writing a book and how to beat it UX legend Steve Krug on applying usability principles to writing your book Robbie Kellman Baxter with a brilliantly practical tip on using writing as a thinking tool Business coach and web strategist Robin Waite on the book as part of the personal brand ecosystem Nicholas Lovell on the Curve - using the power of free to turn followers into superfans Patrick Vlaskovits on hustle and the art of not waiting for permission The Creator's Code author Amy Wilkinson on the myth of overnight success in both business and writing, and the importance of discomfort Andy Cope on his life-changing epiphany in the Tesco's checkout queue (warning: this is the bit where I cry laughing) Think of it as an early Christmas present. You're welcome. 

Steve Krug tells it like it is. 'People don't read nearly as much of [your book] as you think.' Painful though it is, much of writing is actually editing: reworking sentences, cutting out fluff, converting long paragraphs to bullet-points, so that you get your point across.  Steve used all these tricks and more when the wrote the bible of usability experts - Don't Make Me Think. He wanted it to be readable in a two-hour plane journey, because that's about how long his target reader would be able to give it. And to achieve that he did a lot of 'throwing stuff overboard'.  Writing, says Steve is like usability: 'it's all about 'keeping the user in mind and trying to be as kind to them as possible and trying to make it as rewarding an experience for them as you can.' Invaluable, practical and refreshingly sane advice whether you're writing a book or a page of website copy.

Victor Yocco, PhD (@VictorYocco) is a writer and researcher, working in the field of digital design. His background in psychology gives him unique insight into how people interact with websites and applications, which in turn helps his design team build intuitive, functional projects. In this conversation, we discuss methods of user testing, stumbling blocks that design studies make regarding psychology, and a bit of his studio workflow and habits.   Use code pcyobusy to receive 39% off the cover price for Victor's book, Design For The Mind Show Notes & Links Victor Yocco doesn't like titles, but describes himself as a researcher for user experience and digital design "Academic literature is often very inaccessibly written." —Victor Yocco Tweet This Fine Arts vs. Applied Arts Paola Antonelli on The Colbert Report, 2013 MoMA "Incorporated psychology into design doesn't have to be this huge thing." —Victor Yocco Tweet This   Design For The Mind by Victor Yocco on Manning Books   Don't Make Me Think by Steve Krug on Amazon   Big-Ass Buttons "It's so easy a caveman can do it" campaign from Geico [av_video src='https://www.youtube.com/watch?v=e8aj1AlYvxI' format='16-9' width='16' height='9'] heuristics, or mental shortcuts, take the place of finding information yourself. Whiteboard sessions, focus groups, interviews — other research tactics Jeff Sauro, Measuring U Quantifying Usability "You'll find 85% of potential usability issues just off 5 users." —Jeff Sauro Tweet This Lay People, which Prescott affectionately calls "Muggles" The Design of Everyday Things by Don Norman on Amazon and on Audible   "There is a point of 'Good Enough' in digital design." —Victor Yocco Tweet This Analysis Paralysis Minimum Viable Product An earlier episode with Kirsten Modestow Photoshop Sketch Full Stack Anxiety [av_video src='https://www.youtube.com/watch?v=N470hsHKXNc' format='16-9' width='16' height='9'] Spider Web Diagram Distribute Strength, Dexterity, etc. [caption id="attachment_3409" align="alignnone" width="601"]Role-Playing Games require you distribute your skills[/caption] "Designers are usually people who enjoy solving problems." —Victor Yocco Tweet This Sally Hogshead Social Identity Theory Contextual Inquiry, observing the user in his native habitat aka "shadowing" Undercover Boss, the one where the girl puts barcode on her arm for easy scanning Debuke, IA How to un-jam a tractor-trailer from a highway overpass? Let some air out of the tires. 90% of MS Word users only utilise 10% of the features VictorYocco.com Use code pcyobusy to receive 39% off the cover price for Victor's book, Design For The Mind  Victor Yocco on Twitter  Victor Yocco on Facebook  Victor Yocco on LinkedIn Tools SPSS, statistics software MS Office Post-Its Box Slack Techniques Layer Cake approach (low level, medium level, high level) Respect the users' time by making simple interfaces, functions Don't just show your designs to other designers — they think differently, which might not see what the lay person sees Include additional team members, representing design, writing, project mgmt., etc. Record user testing sessions to easily refer other team members to particular moments Conduct a UX Assessment or heuristics Review before beginning a project Habits Build in heuristics (mental shortcuts) into your work Look to Usability testing to reveal users' instinct or assumptions Provide challenges for designers and creative staff; they naturally want to wrestle with problems and their solutions Search for methods to stay with a project until the end (even if you get bored with it) Set aside time in the evening to write TRY AUDIBLE.COM FREE FOR 30-DAYS Visit BusyCreatorBook.com for your free trial Get The Design of Everyday Things by Don Norman as a free audiobook